Clone BO08578 Report

Search the DGRC for BO08578

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:85
Well:78
Vector:pDNR-Dual
Associated Gene/TranscriptArc-p34-RA
Protein status:BO08578.pep: validated full length
Sequenced Size:937

Clone Sequence Records

BO08578.3prime Sequence

853 bp (834 high quality bases) assembled on 2006-01-06

> BO08578.3prime
ATGGTCTAGAAAGCTTGCATCGATGCGCTTGAAAGTTCTCCCCGTTATAG
TTTTCTTCTCCGTGTTTTTGGGCTCTGGCCTTGCACGATTTAGCACCTTG
AGGAAATCCGAGGTTTTTGCTCGCATGCGCGAATGAATGTAAGCCTTTGA
ACACTTAATGTGGTAGTGCAAGTAATCTCGGAACATGTGAATTAAGTTAA
TGGTATTGTCCCTTGTTTCTTTGTTGGTATGCCGAGGGAAGAGTACGAAT
GTGACATAGCCAATGTTGTCGCCCACCCTAGCGTCCGTGTTGGCCAATTC
CAATGGTGGTTCTCGGTGCGAAAAGAGCACTTGTGGTGCGGTGTGCGAGG
CACGCCGACCTTCCCTCAATTCCTGCATAAATACTTTGCCGATAATGACA
TCGTCTTCGTCCCGGAAAATGGTACTAAAGACGACGGTGACACGATCAGG
CTTGGCTTCCACATATAAAGTCTCATCGTTGCGGTAGTTAATGACGGCAC
GCTTTTGGCCCTCTTCGCCCTGCTCCTGATAGTCAAAATACTTTTCAAAA
ACCGATGCGAAACAGTTGCGCTTCAGCAGTCCGATTCTCTTTGCGATTTG
CTCGCAGTCCTCGGGAATCTCCTCCAGGTTGATAAGTACGGAAACATTGT
AGCCTTCTTCCGTGTCTGTAAGCAGACTGCCATATTCACGCTTCAGCAAC
TCGTCGGCTCCATGTTCTTGCAGCTGTTTGTAGAACTTCAGCGATATGCT
GATCCGAACTTTTGTTTTATCGCCATTCACATTGGAAATGTGATAAAGGA
CGCCGTCGAAGTCTGCTATTCGTATGTCTATCGATTCAGGCTTCAGTCCA
GCC

BO08578.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:27:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG10954-PA 906 Arc-p34-RA 69..903 853..19 4175 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:51:11
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc2-RB 1974 CG10954-RB 606..1440 853..19 4175 100 Minus
Arpc2-RA 1941 CG10954-RA 573..1407 853..19 4175 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 18:51:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20420897..20421117 466..246 1105 100 Minus
2L 23513712 2L 20420646..20420834 655..467 945 100 Minus
2L 23513712 2L 20422300..20422412 155..43 565 100 Minus
2L 23513712 2L 20420489..20420590 754..653 510 100 Minus
2L 23513712 2L 20420318..20420412 848..754 475 100 Minus
2L 23513712 2L 20422144..20422236 246..154 465 100 Minus
Blast to na_te.dros performed on 2015-02-12 18:51:09 has no hits.

BO08578.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:51:04 Download gff for BO08578.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10954-PA 69..906 16..853 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:47:21 Download gff for BO08578.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10954-PA 69..906 16..853 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 04:15:06 Download gff for BO08578.3prime
Subject Subject Range Query Range Percent Splice Strand
Arpc2-RA 602..1436 19..853 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 20:22:45 Download gff for BO08578.3prime
Subject Subject Range Query Range Percent Splice Strand
Arpc2-RA 573..1407 19..853 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 20:22:45 Download gff for BO08578.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 20422469..20422493 19..43 100   Minus
2L 20422302..20422411 44..153 100 -> Minus
2L 20422145..20422236 154..245 100 -> Minus
2L 20420897..20421117 246..466 100 -> Minus
2L 20420648..20420834 467..653 100 -> Minus
2L 20420490..20420589 654..753 100 -> Minus
2L 20420313..20420412 754..853 96 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 04:15:06 Download gff for BO08578.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20422469..20422493 19..43 100   Minus
arm_2L 20422302..20422411 44..153 100 -> Minus
arm_2L 20422145..20422236 154..245 100 -> Minus
arm_2L 20420897..20421117 246..466 100 -> Minus
arm_2L 20420648..20420834 467..653 100 -> Minus
arm_2L 20420490..20420589 654..753 100 -> Minus
arm_2L 20420313..20420412 754..853 96 -> Minus

BO08578.5prime Sequence

897 bp (815 high quality bases) assembled on 2006-01-06

> BO08578.5prime
GAAGTTATCAGTCGACATGATCCTGCTGGAAATCAATAATCGGATTATCG
AGGAGACGCTGCTGGTCAAATACCGTAATGCCCAGGCTGGACTGAAGCCT
GAATCGATAGACATACGAATAGCAGACTTCGACGGCGTCCTTTATCACAT
TTCCAATGTGAATGGCGATAAAACAAAAGTTCGGATCAGCATATCGCTGA
AGTTCTACAAACAGCTGCAAGAACATGGAGCCGACGAGTTGCTGAAGCGT
GAATATGGCAGTCTGCTTACAGACACGGAAGAAGGCTACAATGTTTCCGT
ACTTATCAACCTGGAGGAGATTCCCGAGGACTGCGAGCAAATCGCAAAGA
GAATCGGACTGCTGAAGCGCAACTGTTTCGCATCGGTTTTTGAAAAGTAT
TTTGACTATCAGGAGCAGGGCGAAGAGGGCCAAAAGCGTGCCGTCATTAA
CTACCGCAACGATGAGACTTTATATGTGGAAGCCAAGCCTGATCGTGTCA
CCGTCGTCTTTAGTACCATTTTCCGGGACGAAGACGATGTCATTATCGGC
AAAGTATTTATGCAGGAATTGAGGGAAGGTCGGCGTGCCTCGCACACCGC
ACCACAAGTGCTCTTTTCGCACCGAGAACCACCATTGGAATTGGCCAACA
CGGACGCTAGGGTGGGCGACAACATTGGCTATGTCACATTCGTACTCTTC
CCTCGGCATACCAACAAAGAAACAAGGGACAATACCATTAACTTAATTCA
CATGTTCCGAGATTACTTGCACTACCACATTAAGTGTTCAAAGGCTTACA
TTCATTCGCGCATGCGAGCAAAAACCTCGGATTTCCTCAAGGTGCTAAAT
CGTGCAAGGCCAGAGCCCAAAAACACGGAGAAGAAACTATAACGGGG

BO08578.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:27:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG10954-PA 906 Arc-p34-RA 1..870 17..886 4350 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 00:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc2-RB 1974 CG10954-RB 537..1419 16..897 4390 99.9 Plus
Arpc2-RA 1941 CG10954-RA 504..1386 16..897 4390 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 00:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20420897..20421117 472..692 1105 100 Plus
2L 23513712 2L 20420646..20420834 283..471 945 100 Plus
2L 23513712 2L 20422300..20422403 783..886 520 100 Plus
2L 23513712 2L 20420489..20420590 184..285 510 100 Plus
2L 23513712 2L 20420318..20420412 90..184 475 100 Plus
2L 23513712 2L 20422144..20422236 692..784 465 100 Plus
2L 23513712 2L 20417593..20417667 16..90 375 100 Plus
Blast to na_te.dros performed on 2015-02-13 00:09:23 has no hits.

BO08578.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:51:05 Download gff for BO08578.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10954-PA 1..882 17..897 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:47:22 Download gff for BO08578.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10954-PA 1..882 17..897 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 10:20:53 Download gff for BO08578.5prime
Subject Subject Range Query Range Percent Splice Strand
Arpc2-RA 525..1415 8..897 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:54:05 Download gff for BO08578.5prime
Subject Subject Range Query Range Percent Splice Strand
Arpc2-RA 496..1386 8..897 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:54:05 Download gff for BO08578.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 20422302..20422414 785..897 97   Plus
2L 20422145..20422236 693..784 100 -> Plus
2L 20420897..20421117 472..692 100 -> Plus
2L 20420648..20420834 285..471 100 -> Plus
2L 20420490..20420589 185..284 100 -> Plus
2L 20420319..20420412 91..184 100 -> Plus
2L 20417585..20417667 8..90 96 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 10:20:53 Download gff for BO08578.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20422302..20422414 785..897 97   Plus
arm_2L 20422145..20422236 693..784 100 -> Plus
arm_2L 20420897..20421117 472..692 100 -> Plus
arm_2L 20420648..20420834 285..471 100 -> Plus
arm_2L 20420490..20420589 185..284 100 -> Plus
arm_2L 20420319..20420412 91..184 100 -> Plus
arm_2L 20417585..20417667 8..90 96 -> Plus

BO08578.complete Sequence

937 bp (937 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ631245

> BO08578.complete
GAAGTTATCAGTCGACATGATCCTGCTGGAAATCAATAATCGGATTATCG
AGGAGACGCTGCTGGTCAAATACCGTAATGCCCAGGCTGGACTGAAGCCT
GAATCGATAGACATACGAATAGCAGACTTCGACGGCGTCCTTTATCACAT
TTCCAATGTGAATGGCGATAAAACAAAAGTTCGGATCAGCATATCGCTGA
AGTTCTACAAACAGCTGCAAGAACATGGAGCCGACGAGTTGCTGAAGCGT
GAATATGGCAGTCTGCTTACAGACACGGAAGAAGGCTACAATGTTTCCGT
ACTTATCAACCTGGAGGAGATTCCCGAGGACTGCGAGCAAATCGCAAAGA
GAATCGGACTGCTGAAGCGCAACTGTTTCGCATCGGTTTTTGAAAAGTAT
TTTGACTATCAGGAGCAGGGCGAAGAGGGCCAAAAGCGTGCCGTCATTAA
CTACCGCAACGATGAGACTTTATATGTGGAAGCCAAGCCTGATCGTGTCA
CCGTCGTCTTTAGTACCATTTTCCGGGACGAAGACGATGTCATTATCGGC
AAAGTATTTATGCAGGAATTGAGGGAAGGTCGGCGTGCCTCGCACACCGC
ACCACAAGTGCTCTTTTCGCACCGAGAACCACCATTGGAATTGGCCAACA
CGGACGCTAGGGTGGGCGACAACATTGGCTATGTCACATTCGTACTCTTC
CCTCGGCATACCAACAAAGAAACAAGGGACAATACCATTAACTTAATTCA
CATGTTCCGAGATTACTTGCACTACCACATTAAGTGTTCAAAGGCTTACA
TTCATTCGCGCATGCGAGCAAAAACCTCGGATTTCCTCAAGGTGCTAAAT
CGTGCAAGGCCAGAGCCCAAAAACACGGAGAAGAAAACTATAACGGGGAG
AACTTTCAAGCGCATCGATGCAAGCTTTCTAGACCAT

BO08578.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc2-RB 906 CG10954-PB 1..903 17..919 4515 100 Plus
Arpc2-RA 906 CG10954-PA 1..903 17..919 4515 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc2-RB 1974 CG10954-RB 537..1440 16..919 4520 100 Plus
Arpc2-RA 1941 CG10954-RA 504..1407 16..919 4520 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:53:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20420897..20421117 472..692 1105 100 Plus
2L 23513712 2L 20420646..20420834 283..471 945 100 Plus
2L 23513712 2L 20422300..20422412 783..895 565 100 Plus
2L 23513712 2L 20420489..20420590 184..285 510 100 Plus
2L 23513712 2L 20420318..20420412 90..184 475 100 Plus
2L 23513712 2L 20422144..20422236 692..784 465 100 Plus
2L 23513712 2L 20417593..20417667 16..90 375 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:53:12 has no hits.

BO08578.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:11:23 Download gff for BO08578.complete
Subject Subject Range Query Range Percent Splice Strand
Arc-p34-RA 1..906 17..922 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:32:10 Download gff for BO08578.complete
Subject Subject Range Query Range Percent Splice Strand
Arc-p34-RA 525..1436 8..919 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:34:44 Download gff for BO08578.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc2-RA 534..1436 17..921 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:11:24 Download gff for BO08578.complete
Subject Subject Range Query Range Percent Splice Strand
Arc-p34-RA 525..1436 8..919 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:28:52 Download gff for BO08578.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc2-RA 505..1407 17..921 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:28:52 Download gff for BO08578.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20422469..20422493 895..921 92   Plus
2L 20422302..20422411 785..894 100 -> Plus
2L 20422145..20422236 693..784 100 -> Plus
2L 20420897..20421117 472..692 100 -> Plus
2L 20420648..20420834 285..471 100 -> Plus
2L 20420490..20420589 185..284 100 -> Plus
2L 20420319..20420412 91..184 100 -> Plus
2L 20417594..20417667 17..90 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:34:44 Download gff for BO08578.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20422469..20422493 895..921 92   Plus
arm_2L 20422302..20422411 785..894 100 -> Plus
arm_2L 20422145..20422236 693..784 100 -> Plus
arm_2L 20420897..20421117 472..692 100 -> Plus
arm_2L 20420648..20420834 285..471 100 -> Plus
arm_2L 20420490..20420589 185..284 100 -> Plus
arm_2L 20420319..20420412 91..184 100 -> Plus
arm_2L 20417594..20417667 17..90 100 -> Plus

BO08578.pep Sequence

Translation from 16 to 937

> BO08578.pep
MILLEINNRIIEETLLVKYRNAQAGLKPESIDIRIADFDGVLYHISNVNG
DKTKVRISISLKFYKQLQEHGADELLKREYGSLLTDTEEGYNVSVLINLE
EIPEDCEQIAKRIGLLKRNCFASVFEKYFDYQEQGEEGQKRAVINYRNDE
TLYVEAKPDRVTVVFSTIFRDEDDVIIGKVFMQELREGRRASHTAPQVLF
SHREPPLELANTDARVGDNIGYVTFVLFPRHTNKETRDNTINLIHMFRDY
LHYHIKCSKAYIHSRMRAKTSDFLKVLNRARPEPKNTEKKTITGRTFKRI
DASFLDH

BO08578.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc2-PB 301 CG10954-PB 1..301 1..301 1554 100 Plus
Arpc2-PA 301 CG10954-PA 1..301 1..301 1554 100 Plus