Clone BO08585 Report

Search the DGRC for BO08585

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:85
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptVap-33-1-RB
Protein status:BO08585.pep: validated full length
Sequenced Size:841

Clone Sequence Records

BO08585.3prime Sequence

839 bp (838 high quality bases) assembled on 2006-01-06

> BO08585.3prime
ATGGTCTAGAAAGCTTGCGAGAAAGAATTTGCCCAGCAGGAGGCTAACGA
TGGCCGCAGCAATGGCAACTGCAATGTAAAAGACCGGAATCTGCTTCTCA
GCCAGGACTGGGGCATAGGGCTCATTCACCTGTTTGACGGCCGGCGAGCT
CCGGAAACGTGTGATTTGATCCTTCAAGTGAAGATTCTCTCTTCGCAATT
CAATGTTGCATTCACGCAGCGCTTTGATCTCTCCGGACAGCAAGTCCAGA
CTCTCAGACGTTTCGAGCAAATTGGATGGCTTAAACTTATCCTCGCTGGA
GAGCTTCGGCTTGCTCTCGAGCGCCTCAGCGCTGGCTGAGCTAGTATTGG
CACCCGCGCTTCCGCCTCCGGCAGCTCCGGTTCCGCCGCCAACGGCACCA
CCACCGCTGGTGTTCTCAGCATTTGCCTCAGCGGTGGGCATCTCGAAAAC
GCACTTCAGTTTGGCGTCCATCAGCTGCTCGGGCTCCAGATCCTTCCACA
ATTTATTTAAATCGCTTAGATCAGCATCCATGGGTGCCAGGACGCTCTGC
ACCATGAACTTGTGCTTGTTCTTCTCCTGCTGATCGTAGACGAATGGCTG
AAGGCAGATCTCCACCTGGGTTGATCGAAAGGGAATTATCTTGCCGATGT
TTGGACGTACGCAGTAGCGTTTCGGGGCGGTTGTCTTGATCTTGAAGACC
AGAGGCAGAGCCGAGTTGTTGCGCAGAGTCATGATTGTGACAACGGGTCG
GGTGAAGGGACCCACAAAACGCAACTCATGTTCTGGTTCAATGGTCAACG
GAAGATCAAAGAGTGATTTGCTCATGTCGACTGATAACT

BO08585.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:27:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG5014-PB 810 Vap-33-1-RB 1..807 825..19 4035 100 Minus
CG5014-PC 810 Vap-33-1-RC 1..807 825..19 4035 100 Minus
CG5014-PD 717 Vap-33-1-RD 1..714 732..19 3570 100 Minus
CG5014-PA 708 Vap-33-1-RA 1..401 825..425 2005 100 Minus
CG5014-PA 708 Vap-33-1-RA 393..705 331..19 1565 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 14:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
Vap-33A-RE 3897 CG5014-RE 568..1374 825..19 4035 100 Minus
Vap-33A-RC 3607 CG5014-RC 278..1084 825..19 4035 100 Minus
Vap-33A-RB 2541 CG5014-RB 568..1374 825..19 4035 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 14:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3951828..3952041 499..286 1070 100 Minus
X 23542271 X 3952761..3952919 177..19 780 99.4 Minus
X 23542271 X 3951414..3951567 762..609 770 100 Minus
X 23542271 X 3952106..3952222 287..171 585 100 Minus
X 23542271 X 3951636..3951745 608..499 550 100 Minus
X 23542271 X 3949650..3949715 825..760 330 100 Minus
Blast to na_te.dros performed on 2015-02-08 14:46:50 has no hits.

BO08585.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:51:16 Download gff for BO08585.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5014-PC 1..810 16..825 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:47:37 Download gff for BO08585.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5014-PC 1..810 16..825 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:59:25 Download gff for BO08585.3prime
Subject Subject Range Query Range Percent Splice Strand
Vap-33-1-RB 568..1378 15..825 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 15:39:18 Download gff for BO08585.3prime
Subject Subject Range Query Range Percent Splice Strand
Vap-33A-RB 568..1378 15..825 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 15:39:18 Download gff for BO08585.3prime
Subject Subject Range Query Range Percent Splice Strand
X 3952767..3952924 14..171 98 -> Minus
X 3952108..3952221 172..285 100 -> Minus
X 3951829..3952041 286..498 100 -> Minus
X 3951636..3951745 499..608 100 -> Minus
X 3951415..3951567 609..761 100 -> Minus
X 3949650..3949713 762..825 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:59:25 Download gff for BO08585.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 3846800..3846957 14..171 98 -> Minus
arm_X 3846141..3846254 172..285 100 -> Minus
arm_X 3845862..3846074 286..498 100 -> Minus
arm_X 3845669..3845778 499..608 100 -> Minus
arm_X 3845448..3845600 609..761 100 -> Minus
arm_X 3843683..3843746 762..825 100 -> Minus

BO08585.5prime Sequence

839 bp (806 high quality bases) assembled on 2006-01-06

> BO08585.5prime
GAAGTTATCAGTCGACATGAGCAAATCACTCTTTGATCTTCCGTTGACCA
TTGAACCAGAACATGAGTTGCGTTTTGTGGGTCCCTTCACCCGACCCGTT
GTCACAATCATGACTCTGCGCAACAACTCGGCTCTGCCTCTGGTCTTCAA
GATCAAGACAACCGCCCCGAAACGCTACTGCGTACGTCCAAACATCGGCA
AGATAATTCCCTTTCGATCAACCCAGGTGGAGATCTGCCTTCAGCCATTC
GTCTACGATCAGCAGGAGAAGAACAAGCACAAGTTCATGGTGCAGAGCGT
CCTGGCACCCATGGATGCTGATCTAAGCGATTTAAATAAATTGTGGAAGG
ATCTGGAGCCCGAGCAGCTGATGGACGCCAAACTGAAGTGCGTTTTCGAG
ATGCCCACCGCTGAGGCAAATGCTGAGAACACCAGCGGTGGTGGTGCCGT
TGGCGGCGGAACCGGAGCTGCCGGAGGCGGAAGCGCGGGTGCCAATACTA
GCTCAGCCAGCGCTGAGGCGCTCGAGAGCAAGCCGAAGCTCTCCAGCGAG
GATAAGTTTAAGCCATCCAATTTGCTCGAAACGTCTGAGAGTCTGGACTT
GCTGTCCGGAGAGATCAAAGCGCTGCGTGAATGCAACATTGAATTGCGAA
GAGAGAATCTTCACTTGAAGGATCAAATCACACGTTTCCGGAGCTCGCCG
GCCGTCAAACAGGTGAATGAGCCCTATGCCCCAGTCCTGGCTGAGAAGCA
GATTCCGGTCTTTTACATTGCAGTTGCCATTGCTGCGGCCATCGTTAGCC
TCCTGCTGGGCAAATTCTTTCTCGCAAGCTTTCTAGACC

BO08585.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:27:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG5014-PB 810 Vap-33-1-RB 1..807 17..823 4035 100 Plus
CG5014-PC 810 Vap-33-1-RC 1..807 17..823 4035 100 Plus
CG5014-PD 717 Vap-33-1-RD 1..714 110..823 3570 100 Plus
CG5014-PA 708 Vap-33-1-RA 1..401 17..417 2005 100 Plus
CG5014-PA 708 Vap-33-1-RA 393..705 511..823 1565 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 12:10:46
Subject Length Description Subject Range Query Range Score Percent Strand
Vap-33A-RE 3897 CG5014-RE 568..1374 17..823 4035 100 Plus
Vap-33A-RC 3607 CG5014-RC 278..1084 17..823 4035 100 Plus
Vap-33A-RB 2541 CG5014-RB 568..1374 17..823 4035 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 12:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3951828..3952041 343..556 1070 100 Plus
X 23542271 X 3952761..3952919 665..823 780 99.4 Plus
X 23542271 X 3951414..3951567 80..233 770 100 Plus
X 23542271 X 3952106..3952222 555..671 585 100 Plus
X 23542271 X 3951636..3951745 234..343 550 100 Plus
X 23542271 X 3949650..3949715 17..82 330 100 Plus
Blast to na_te.dros performed on 2015-02-12 12:10:42 has no hits.

BO08585.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:51:17 Download gff for BO08585.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5014-PC 1..810 17..826 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:47:38 Download gff for BO08585.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5014-PC 1..810 17..826 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 05:57:34 Download gff for BO08585.5prime
Subject Subject Range Query Range Percent Splice Strand
Vap-33-1-RB 568..1378 17..827 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:58:46 Download gff for BO08585.5prime
Subject Subject Range Query Range Percent Splice Strand
Vap-33A-RB 568..1378 17..827 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:58:46 Download gff for BO08585.5prime
Subject Subject Range Query Range Percent Splice Strand
X 3952767..3952924 671..828 98 -> Plus
X 3952108..3952221 557..670 100 -> Plus
X 3951829..3952041 344..556 100 -> Plus
X 3951636..3951745 234..343 100 -> Plus
X 3951415..3951567 81..233 100 -> Plus
X 3949650..3949713 17..80 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 05:57:34 Download gff for BO08585.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 3846800..3846957 671..828 98 -> Plus
arm_X 3846141..3846254 557..670 100 -> Plus
arm_X 3845862..3846074 344..556 100 -> Plus
arm_X 3845669..3845778 234..343 100 -> Plus
arm_X 3845448..3845600 81..233 100 -> Plus
arm_X 3843683..3843746 17..80 100 -> Plus

BO08585.complete Sequence

841 bp (841 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ631247

> BO08585.complete
GAAGTTATCAGTCGACATGAGCAAATCACTCTTTGATCTTCCGTTGACCA
TTGAACCAGAACATGAGTTGCGTTTTGTGGGTCCCTTCACCCGACCCGTT
GTCACAATCATGACTCTGCGCAACAACTCGGCTCTGCCTCTGGTCTTCAA
GATCAAGACAACCGCCCCGAAACGCTACTGCGTACGTCCAAACATCGGCA
AGATAATTCCCTTTCGATCAACCCAGGTGGAGATCTGCCTTCAGCCATTC
GTCTACGATCAGCAGGAGAAGAACAAGCACAAGTTCATGGTGCAGAGCGT
CCTGGCACCCATGGATGCTGATCTAAGCGATTTAAATAAATTGTGGAAGG
ATCTGGAGCCCGAGCAGCTGATGGACGCCAAACTGAAGTGCGTTTTCGAG
ATGCCCACCGCTGAGGCAAATGCTGAGAACACCAGCGGTGGTGGTGCCGT
TGGCGGCGGAACCGGAGCTGCCGGAGGCGGAAGCGCGGGTGCCAATACTA
GCTCAGCCAGCGCTGAGGCGCTCGAGAGCAAGCCGAAGCTCTCCAGCGAG
GATAAGTTTAAGCCATCCAATTTGCTCGAAACGTCTGAGAGTCTGGACTT
GCTGTCCGGAGAGATCAAAGCGCTGCGTGAATGCAACATTGAATTGCGAA
GAGAGAATCTTCACTTGAAGGATCAAATCACACGTTTCCGGAGCTCGCCG
GCCGTCAAACAGGTGAATGAGCCCTATGCCCCAGTCCTGGCTGAGAAGCA
GATTCCGGTCTTTTACATTGCAGTTGCCATTGCTGCGGCCATCGTTAGCC
TCCTGCTGGGCAAATTCTTTCTCGCAAGCTTTCTAGACCAT

BO08585.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:44:56
Subject Length Description Subject Range Query Range Score Percent Strand
Vap-33A-RE 810 CG5014-PE 1..807 17..823 4035 100 Plus
Vap-33A-RC 810 CG5014-PC 1..807 17..823 4035 100 Plus
Vap-33A-RB 810 CG5014-PB 1..807 17..823 4035 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
Vap-33A-RE 3897 CG5014-RE 568..1374 17..823 4035 100 Plus
Vap-33A-RC 3607 CG5014-RC 278..1084 17..823 4035 100 Plus
Vap-33A-RB 2541 CG5014-RB 568..1374 17..823 4035 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:44:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3951828..3952041 343..556 1070 100 Plus
X 23542271 X 3952761..3952919 665..823 780 99.4 Plus
X 23542271 X 3951414..3951567 80..233 770 100 Plus
X 23542271 X 3952106..3952222 555..671 585 100 Plus
X 23542271 X 3951636..3951745 234..343 550 100 Plus
X 23542271 X 3949650..3949715 17..82 330 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:44:55 has no hits.

BO08585.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:00:34 Download gff for BO08585.complete
Subject Subject Range Query Range Percent Splice Strand
Vap-33-1-RC 1..810 17..826 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:32:40 Download gff for BO08585.complete
Subject Subject Range Query Range Percent Splice Strand
Vap-33-1-RC 223..1033 17..827 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:32:35 Download gff for BO08585.complete
Subject Subject Range Query Range Percent Splice Strand
Vap-33-1-RB 568..1374 17..825 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:00:35 Download gff for BO08585.complete
Subject Subject Range Query Range Percent Splice Strand
Vap-33-1-RC 223..1033 17..827 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:25:38 Download gff for BO08585.complete
Subject Subject Range Query Range Percent Splice Strand
Vap-33A-RB 568..1374 17..825 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:25:38 Download gff for BO08585.complete
Subject Subject Range Query Range Percent Splice Strand
X 3952767..3952919 671..825 98   Plus
X 3952108..3952221 557..670 100 -> Plus
X 3951829..3952041 344..556 100 -> Plus
X 3951636..3951745 234..343 100 -> Plus
X 3951415..3951567 81..233 100 -> Plus
X 3949650..3949713 17..80 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:32:35 Download gff for BO08585.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 3846800..3846952 671..825 98   Plus
arm_X 3846141..3846254 557..670 100 -> Plus
arm_X 3845862..3846074 344..556 100 -> Plus
arm_X 3845669..3845778 234..343 100 -> Plus
arm_X 3845448..3845600 81..233 100 -> Plus
arm_X 3843683..3843746 17..80 100 -> Plus

BO08585.pep Sequence

Translation from 16 to 841

> BO08585.pep
MSKSLFDLPLTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTA
PKRYCVRPNIGKIIPFRSTQVEICLQPFVYDQQEKNKHKFMVQSVLAPMD
ADLSDLNKLWKDLEPEQLMDAKLKCVFEMPTAEANAENTSGGGAVGGGTG
AAGGGSAGANTSSASAEALESKPKLSSEDKFKPSNLLETSESLDLLSGEI
KALRECNIELRRENLHLKDQITRFRSSPAVKQVNEPYAPVLAEKQIPVFY
IAVAIAAAIVSLLLGKFFLASFLDH

BO08585.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
Vap-33A-PE 269 CG5014-PE 1..269 1..269 1362 100 Plus
Vap-33A-PC 269 CG5014-PC 1..269 1..269 1362 100 Plus
Vap-33A-PB 269 CG5014-PB 1..269 1..269 1362 100 Plus
Vap-33A-PA 235 CG5014-PA 1..235 1..269 1148 87.4 Plus
fan-PA 218 CG7919-PA 9..140 10..145 210 35 Plus