Clone BO08848 Report

Search the DGRC for BO08848

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:88
Well:48
Vector:pDNR-Dual
Associated Gene/Transcriptdlg1-RC
Protein status:BO08848.pep: validated full length
Sequenced Size:658

Clone Sequence Records

BO08848.5prime Sequence

656 bp (655 high quality bases) assembled on 2006-01-09

> BO08848.5prime
GAAGTTATCAGTCGACATGCCAGTGAAAAAGCAAGAAGCTCATCGGGCTC
TCGAGCTGCTCGAGGACTACCACGCGAGACTTTCGGAGCCGCAGGATCGG
GCGCTGCGTATTGCAATCGAACGCGTTATACGCATATTTAAATCTCGCTT
GTTTCAAGCGCTGTTAGATATACAAGAATTCTATGAATTGACATTATTGG
ATGACTCGAAGAGCATACAACAAAAGACAGCGGAGACCTTGCAAATTGCA
ACCAAATGGGAAAAGGATGGCCAGGCAGTCAAAATAGCTGATAATCAGCG
CATGCGCATCGAATCGGACACGGAAAATGCCAAGGAGCCAACTGTCGAGC
AGCAGCAAAAGCAGCAGCAAGCGCAGCAGCGCAGTTCCCGCTCCCCGCAG
CAGCAGAATCCGCAGCAGCAGCAGGGATCCAAATCGAGGAGCGGGTCCCA
GACTTCACAGATACAGATACAGTCACTTACACAGACATACCCAAACGCAC
ACCAGCGCAAGCGAGTCCTCGTGAGCCTCCATCCACATCAACATCAACAT
CAAAGCCAAATTCAACACCAACACCATTACCAACTTCGCCATAACAACGG
CATTCAAGCCAAAATGCTTAAGCGCGCTTTTGAGTCCACCGCAAGCTTTC
TAGACC

BO08848.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:30:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG1725-PC 627 dlg1-RC 1..624 17..640 3120 100 Plus
CG1725-PJ 627 dlg1-RJ 1..624 17..640 3120 100 Plus
CG1725-PI 627 dlg1-RI 1..624 17..640 3120 100 Plus
CG1725-PH 2736 dlg1-RH 1..438 17..454 2190 100 Plus
CG1725-PB 2913 dlg1-RB 1..276 17..292 1380 100 Plus
CG1725-PF 2451 dlg1-RF 911..1167 36..292 1285 100 Plus
CG1725-PB 2913 dlg1-RB 454..615 293..454 810 100 Plus
CG1725-PF 2451 dlg1-RF 1345..1506 293..454 810 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:53:48
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-RI 2114 CG1725-RI 371..994 17..640 3120 100 Plus
dlg1-RJ 2102 CG1725-RJ 359..982 17..640 3120 100 Plus
dlg1-RC 2554 CG1725-RC 811..1434 17..640 3120 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 10:53:40
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11387986..11388171 455..640 930 100 Plus
X 23542271 X 11387772..11387933 293..454 810 100 Plus
X 23542271 X 11376840..11376973 34..167 670 100 Plus
X 23542271 X 11381854..11381980 166..292 635 100 Plus
Blast to na_te.dros performed 2015-02-11 10:53:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2285..2538 328..584 222 57.7 Plus
Doc3-element 4740 Doc3-element DOC3 4740bp 549..634 530..614 130 62.8 Plus
rover 7318 rover ROVER 7318bp 1930..1997 545..612 123 68.1 Plus

BO08848.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:55:05 Download gff for BO08848.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1725-PI 1..627 17..641 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:52:47 Download gff for BO08848.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1725-PJ 1..627 17..641 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 02:01:23 Download gff for BO08848.5prime
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 804..1440 8..649 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:46:34 Download gff for BO08848.5prime
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 804..1440 8..649 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:46:34 Download gff for BO08848.5prime
Subject Subject Range Query Range Percent Splice Strand
X 11387986..11388177 455..649 97   Plus
X 11387772..11387933 293..454 100 -> Plus
X 11381856..11381980 168..292 100 -> Plus
X 11376842..11376973 36..167 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 02:01:23 Download gff for BO08848.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 11282019..11282210 455..649 97   Plus
arm_X 11281805..11281966 293..454 100 -> Plus
arm_X 11275889..11276013 168..292 100 -> Plus
arm_X 11270875..11271006 36..167 100 -> Plus

BO08848.3prime Sequence

656 bp (655 high quality bases) assembled on 2006-01-10

> BO08848.3prime
ATGGTCTAGAAAGCTTGCGGTGGACTCAAAAGCGCGCTTAAGCATTTTGG
CTTGAATGCCGTTGTTATGGCGAAGTTGGTAATGGTGTTGGTGTTGAATT
TGGCTTTGATGTTGATGTTGATGTGGATGGAGGCTCACGAGGACTCGCTT
GCGCTGGTGTGCGTTTGGGTATGTCTGTGTAAGTGACTGTATCTGTATCT
GTGAAGTCTGGGACCCGCTCCTCGATTTGGATCCCTGCTGCTGCTGCGGA
TTCTGCTGCTGCGGGGAGCGGGAACTGCGCTGCTGCGCTTGCTGCTGCTT
TTGCTGCTGCTCGACAGTTGGCTCCTTGGCATTTTCCGTGTCCGATTCGA
TGCGCATGCGCTGATTATCAGCTATTTTGACTGCCTGGCCATCCTTTTCC
CATTTGGTTGCAATTTGCAAGGTCTCCGCTGTCTTTTGTTGTATGCTCTT
CGAGTCATCCAATAATGTCAATTCATAGAATTCTTGTATATCTAACAGCG
CTTGAAACAAGCGAGATTTAAATATGCGTATAACGCGTTCGATTGCAATA
CGCAGCGCCCGATCCTGCGGCTCCGAAAGTCTCGCGTGGTAGTCCTCGAG
CAGCTCGAGAGCCCGATGAGCTTCTTGCTTTTTCACTGGCATGTCGACTG
ATAACT

BO08848.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:30:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG1725-PC 627 dlg1-RC 1..624 642..19 3120 100 Minus
CG1725-PJ 627 dlg1-RJ 1..624 642..19 3120 100 Minus
CG1725-PI 627 dlg1-RI 1..624 642..19 3120 100 Minus
CG1725-PH 2736 dlg1-RH 1..438 642..205 2190 100 Minus
CG1725-PB 2913 dlg1-RB 1..276 642..367 1380 100 Minus
CG1725-PF 2451 dlg1-RF 911..1167 623..367 1285 100 Minus
CG1725-PB 2913 dlg1-RB 454..615 366..205 810 100 Minus
CG1725-PF 2451 dlg1-RF 1345..1506 366..205 810 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 19:14:20
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-RI 2114 CG1725-RI 371..994 642..19 3120 100 Minus
dlg1-RJ 2102 CG1725-RJ 359..982 642..19 3120 100 Minus
dlg1-RC 2554 CG1725-RC 811..1434 642..19 3120 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 19:14:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11387986..11388171 204..19 930 100 Minus
X 23542271 X 11387772..11387933 366..205 810 100 Minus
X 23542271 X 11376840..11376973 625..492 670 100 Minus
X 23542271 X 11381854..11381980 493..367 635 100 Minus
Blast to na_te.dros performed 2015-02-10 19:14:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2285..2538 331..75 222 57.7 Minus
Doc3-element 4740 Doc3-element DOC3 4740bp 549..634 129..45 130 62.8 Minus
rover 7318 rover ROVER 7318bp 1930..1997 114..47 123 68.1 Minus

BO08848.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:55:04 Download gff for BO08848.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1725-PI 1..627 18..642 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:52:45 Download gff for BO08848.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1725-PJ 1..627 18..642 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 19:01:11 Download gff for BO08848.3prime
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 804..1440 10..651 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:33:39 Download gff for BO08848.3prime
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 804..1440 10..651 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 21:33:39 Download gff for BO08848.3prime
Subject Subject Range Query Range Percent Splice Strand
X 11387986..11388177 10..204 97   Minus
X 11387772..11387933 205..366 100 -> Minus
X 11381856..11381980 367..491 100 -> Minus
X 11376842..11376973 492..623 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 19:01:11 Download gff for BO08848.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 11282019..11282210 10..204 97   Minus
arm_X 11281805..11281966 205..366 100 -> Minus
arm_X 11275889..11276013 367..491 100 -> Minus
arm_X 11270875..11271006 492..623 100 -> Minus

BO08848.complete Sequence

658 bp (658 high quality bases) assembled on 2006-01-18

GenBank Submission: FJ631287

> BO08848.complete
GAAGTTATCAGTCGACATGCCAGTGAAAAAGCAAGAAGCTCATCGGGCTC
TCGAGCTGCTCGAGGACTACCACGCGAGACTTTCGGAGCCGCAGGATCGG
GCGCTGCGTATTGCAATCGAACGCGTTATACGCATATTTAAATCTCGCTT
GTTTCAAGCGCTGTTAGATATACAAGAATTCTATGAATTGACATTATTGG
ATGACTCGAAGAGCATACAACAAAAGACAGCGGAGACCTTGCAAATTGCA
ACCAAATGGGAAAAGGATGGCCAGGCAGTCAAAATAGCTGATAATCAGCG
CATGCGCATCGAATCGGACACGGAAAATGCCAAGGAGCCAACTGTCGAGC
AGCAGCAAAAGCAGCAGCAAGCGCAGCAGCGCAGTTCCCGCTCCCCGCAG
CAGCAGAATCCGCAGCAGCAGCAGGGATCCAAATCGAGGAGCGGGTCCCA
GACTTCACAGATACAGATACAGTCACTTACACAGACATACCCAAACGCAC
ACCAGCGCAAGCGAGTCCTCGTGAGCCTCCATCCACATCAACATCAACAT
CAAAGCCAAATTCAACACCAACACCATTACCAACTTCGCCATAACAACGG
CATTCAAGCCAAAATGCTTAAGCGCGCTTTTGAGTCCACCGCAAGCTTTC
TAGACCAT

BO08848.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-RI 627 CG1725-PI 1..624 17..640 3120 100 Plus
dlg1-RJ 627 CG1725-PJ 1..624 17..640 3120 100 Plus
dlg1-RC 627 CG1725-PC 1..624 17..640 3120 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:32:17
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-RI 2114 CG1725-RI 371..994 17..640 3120 100 Plus
dlg1-RJ 2102 CG1725-RJ 359..982 17..640 3120 100 Plus
dlg1-RC 2554 CG1725-RC 811..1434 17..640 3120 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:32:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11387986..11388171 455..640 930 100 Plus
X 23542271 X 11387772..11387933 293..454 810 100 Plus
X 23542271 X 11376840..11376973 34..167 670 100 Plus
X 23542271 X 11381854..11381980 166..292 635 100 Plus
Blast to na_te.dros performed 2014-11-28 08:32:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2285..2538 328..584 222 57.7 Plus
Doc3-element 4740 Doc3-element DOC3 4740bp 549..634 530..614 130 62.8 Plus
rover 7318 rover ROVER 7318bp 1930..1997 545..612 123 68.1 Plus

BO08848.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:04:26 Download gff for BO08848.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RI 1..627 17..641 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:55:19 Download gff for BO08848.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RI 399..1022 17..642 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:22:04 Download gff for BO08848.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 811..1434 17..642 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:04:26 Download gff for BO08848.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RI 392..1028 8..649 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:20:07 Download gff for BO08848.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RC 811..1434 17..642 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:20:07 Download gff for BO08848.complete
Subject Subject Range Query Range Percent Splice Strand
X 11387986..11388171 455..642 98   Plus
X 11387772..11387933 293..454 100 -> Plus
X 11381856..11381980 168..292 100 -> Plus
X 11376842..11376973 36..167 100 -> Plus
X 11374492..11374510 17..35 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:22:04 Download gff for BO08848.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11282019..11282204 455..642 98   Plus
arm_X 11281805..11281966 293..454 100 -> Plus
arm_X 11275889..11276013 168..292 100 -> Plus
arm_X 11270875..11271006 36..167 100 -> Plus
arm_X 11268525..11268543 17..35 100 -> Plus

BO08848.pep Sequence

Translation from 16 to 658

> BO08848.pep
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTVEQQQKQQQAQQRSSRSPQQQNPQQQQGSKSRSGSQTSQIQ
IQSLTQTYPNAHQRKRVLVSLHPHQHQHQSQIQHQHHYQLRHNNGIQAKM
LKRAFESTASFLDH

BO08848.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-PI 208 CG1725-PI 1..208 1..208 1055 100 Plus
dlg1-PJ 208 CG1725-PJ 1..208 1..208 1055 100 Plus
dlg1-PC 208 CG1725-PC 1..208 1..208 1055 100 Plus
dlg1-PO 206 CG1725-PO 1..206 1..208 1033 99 Plus
dlg1-PU 198 CG1725-PU 1..198 1..208 989 95.2 Plus