Clone BO08865 Report

Search the DGRC for BO08865

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:88
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptIap2-RA
Protein status:BO08865.pep: validated full length
Sequenced Size:1528

Clone Sequence Records

BO08865.3prime Sequence

900 bp (759 high quality bases) assembled on 2006-01-10

> BO08865.3prime
ATGGTCTAGAAAGCTTGCCGAAAGGAACGTGCGCACGAATCCCTTGATGT
CTGCGCGGCACATGGGACAATTGGCTACACTGGGGGCGCACTGATTGCAG
GTGGCCAAGTGGCCACAGGGCAGGAACACTACGCCAACCTCCTCGTCCAA
GCATACCTTGCATAAGCGTGCATCCTTTAGCTGGCGGTTTTCCTCCTCCA
GCGATAGGTTTCCGTTCGGCGTGGCCACCGACATCTTTTGTATTTCGTCT
GTGATTTTCGATATATTCGCCACTGCTTCAGCTGCCTGTGGTTTGGCTGG
GATGGAATCGGCCACCGGTATTGGCACAGATGCTGCCTTGCTGGTGGTGG
CCTGACATGGTTCAATAAAAGGAGCACTTGGCTCCGGCGGCTCGCGCACC
TCCAGTGCAGCTCCTGCGCCCGCATCGTCAAAGATGTCATGCAATAGTTC
GTCCAACGTAGAGAAAGCGCAGCCGGAACTCAAGAGCTTGCGCTGGATGG
CATTGCGCACAACTCCTCCATCGATACCCAAGGCTAGGGCCTCCTTGGCC
GGAGCTTCATCCATCAGTACGTCTGCTTGGAGCGTTGGAGCCGGAGCAGT
TGCTGGCTGGGAACTGGCGTTGGCAGCTGTTGTCGCGAGCACTTCGCTTA
CATAGGCTGGACCCTTGGCCAGCAAAACGAACTGACACTTTGGCGACCAC
TTGGCGTGTTCGAACCACGGCTCGTCCTCCTTCTGCCAGGAGCGCAATCC
AATGTTGCAGTGGAAACAGCGCACCTGGTCGCCTATTTTCTGATAATATA
GGCCAGCCTGCGCCAAAGCCGAAGCGGGCTGAATATTGGAAATGGGCCAA
TCGGTGAAGGTTCTCAATCTGGCGTCCACGCANGCGTACTTGGGACGCAG

BO08865.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:30:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG8293-PA 1497 Iap2-RA 613..1494 900..19 4391 99.8 Minus
CG8293-PB 1497 Iap2-RB 613..1494 900..19 4391 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 04:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
Diap2-RB 1997 CG8293-RB 651..1532 900..19 4399 99.9 Minus
Diap2-RA 2106 CG8293-RA 760..1641 900..19 4399 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 04:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15932784..15933579 105..900 3969 99.9 Plus
2R 25286936 2R 15932635..15932721 19..105 435 100 Plus
Blast to na_te.dros performed on 2015-02-12 04:15:15 has no hits.

BO08865.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:55:34 Download gff for BO08865.3prime
Subject Subject Range Query Range Percent Splice Strand
Iap2-PB 613..1497 16..900 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:53:31 Download gff for BO08865.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8293-PB 613..1497 16..900 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 22:42:03 Download gff for BO08865.3prime
Subject Subject Range Query Range Percent Splice Strand
Iap2-RA 760..1646 14..900 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:59:52 Download gff for BO08865.3prime
Subject Subject Range Query Range Percent Splice Strand
Diap2-RA 760..1646 14..900 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 06:59:52 Download gff for BO08865.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 15932784..15933579 105..900 99   Plus
2R 15932630..15932720 14..104 97 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 22:42:03 Download gff for BO08865.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11820289..11821084 105..900 99   Plus
arm_2R 11820135..11820225 14..104 97 <- Plus

BO08865.5prime Sequence

915 bp (736 high quality bases) assembled on 2006-01-09

> BO08865.5prime
GAAGTTATCAGTCGACATGACGGAGCTGGGCATGGAGCTGGAGAGCGTTC
GCCTGGCGACATTTGGGGAATGGCCCCTGAATGCCCCAGTTTCCGCGGAG
GATCTGGTCGCCAATGGTTTCTTTGCCACGGGAAACTGGCTGGAGGCCGA
GTGCCATTTCTGCCACGTGCGCATCGACCGCTGGGAATACGGCGATCAAG
TGGCGGAGCGCCATCGCCGCTCCTCGCCCATCTGCTCCATGGTTCTGGCT
CCCAATCACTGCGGCAATGTTCCCAGGAGCCAGGAGAGCGACAACGAGGG
AAACAGCGTAGTGGACAGCCCGGAGTCCTGCTCTTGTCCCGATCTCTTGT
TGGAGGCCAATCGCTTGGTAACTTTCAAGGACTGGCCGAATCCCAACATC
ACGCCGCAGGCTCTGGCAAAGGCAGGTTTCTACTACCTGAACCGTCTGGA
TCACGTGAAGTGTGTTTGGTGCAACGGAGTGATTGCCAAGTGGGAGAAGA
ACGACAATGCCTTTGAAGAGCACAAGCGCTTTTTTCCCCAATGTCCTCGT
GTGCAAATGGGCCCCCTTATAGAGTTTGCCACCGGGAAGAACCTGGATGA
GCTGGGCATCCAGCCCACCACTCTGCCACTGCGTCCCAAGTACGCCTGCG
TGGACGCCAGATTGAGAACCTTCACCGATTGGCCCATTTCCAATATTCAG
CCCGCTTCGGCTTTGGCGCAGGCTGGCCTATATTATCAGAAAATAGGCGA
CCAGGTGCGCTGTTTCCACTGCAACATTGGATTGCGCTCCTGGCAGAAGG
AGGACGAGCCGTGGTTCGAACACGCCCAGTGGTCGCCAAAGTGTCAGTTC
GTTTTGCTGGCCCAGGGTCCAGCCTATGTAAGCGAAGTGCTCGCGACAAC
AGCTGCCAACGCCAG

BO08865.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:30:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG8293-PA 1497 Iap2-RA 1..899 17..915 4445 99.7 Plus
CG8293-PB 1497 Iap2-RB 1..899 17..915 4445 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 07:55:30
Subject Length Description Subject Range Query Range Score Percent Strand
Diap2-RB 1997 CG8293-RB 39..937 17..915 4465 99.8 Plus
Diap2-RA 2106 CG8293-RA 148..1046 17..915 4465 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 07:55:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15933293..15933820 915..388 2610 99.6 Minus
2R 25286936 2R 15934199..15934570 388..17 1860 100 Minus
Blast to na_te.dros performed on 2015-02-13 07:55:29 has no hits.

BO08865.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:55:36 Download gff for BO08865.5prime
Subject Subject Range Query Range Percent Splice Strand
Iap2-PB 1..899 17..915 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:53:32 Download gff for BO08865.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8293-PB 1..899 17..915 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 09:51:29 Download gff for BO08865.5prime
Subject Subject Range Query Range Percent Splice Strand
Iap2-RA 148..1046 17..915 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 10:02:38 Download gff for BO08865.5prime
Subject Subject Range Query Range Percent Splice Strand
Diap2-RA 148..1046 17..915 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 10:02:38 Download gff for BO08865.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 15934199..15934570 17..388 100   Minus
2R 15933293..15933819 389..915 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 09:51:29 Download gff for BO08865.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11821704..11822075 17..388 100   Minus
arm_2R 11820798..11821324 389..915 99 <- Minus

BO08865.complete Sequence

1528 bp (1528 high quality bases) assembled on 2006-01-18

GenBank Submission: FJ631295

> BO08865.complete
GAAGTTATCAGTCGACATGACGGAGCTGGGCATGGAGCTGGAGAGCGTTC
GCCTGGCGACATTTGGGGAATGGCCCCTGAATGCCCCAGTTTCCGCGGAG
GATCTGGTCGCCAATGGTTTCTTTGCCACGGGAAACTGGCTGGAGGCCGA
GTGCCATTTCTGCCACGTGCGCATCGACCGCTGGGAATACGGCGATCAAG
TGGCGGAGCGCCATCGCCGCTCCTCGCCCATCTGCTCCATGGTTCTGGCT
CCCAATCACTGCGGCAATGTTCCCAGGAGCCAGGAGAGCGACAACGAGGG
AAACAGCGTAGTGGACAGCCCGGAGTCCTGCTCTTGTCCCGATCTCTTGT
TGGAGGCCAATCGCTTGGTAACTTTCAAGGACTGGCCGAATCCCAACATC
ACGCCGCAGGCTCTGGCAAAGGCAGGTTTCTACTACCTGAACCGTCTGGA
TCACGTGAAGTGTGTTTGGTGCAACGGAGTGATTGCCAAGTGGGAGAAGA
ACGACAATGCCTTTGAAGAGCACAAGCGCTTTTTTCCCCAATGTCCTCGT
GTGCAAATGGGCCCCCTTATAGAGTTTGCCACCGGGAAGAACCTGGATGA
GCTGGGCATCCAGCCCACCACTCTGCCACTGCGTCCCAAGTACGCCTGCG
TGGACGCCAGATTGAGAACCTTCACCGATTGGCCCATTTCCAATATTCAG
CCCGCTTCGGCTTTGGCGCAGGCTGGCCTATATTATCAGAAAATAGGCGA
CCAGGTGCGCTGTTTCCACTGCAACATTGGATTGCGCTCCTGGCAGAAGG
AGGACGAGCCGTGGTTCGAACACGCCAAGTGGTCGCCAAAGTGTCAGTTC
GTTTTGCTGGCCAAGGGTCCAGCCTATGTAAGCGAAGTGCTCGCGACAAC
AGCTGCCAACGCCAGTTCCCAGCCAGCAACTGCTCCGGCTCCAACGCTCC
AAGCAGACGTACTGATGGATGAAGCTCCGGCCAAGGAGGCCCTAGCCTTG
GGTATCGATGGAGGAGTTGTGCGCAATGCCATCCAGCGCAAGCTCTTGAG
TTCCGGCTGCGCTTTCTCTACGTTGGACGAACTATTGCATGACATCTTTG
ACGATGCGGGCGCAGGAGCTGCACTGGAGGTGCGCGAGCCGCCGGAGCCA
AGTGCTCCTTTTATTGAACCATGTCAGGCCACCACCAGCAAGGCAGCATC
TGTGCCAATACCGGTGGCCGATTCCATCCCAGCCAAACCACAGGCAGCTG
AAGCAGTGGCGAATATATCGAAAATCACAGACGAAATACAAAAGATGTCG
GTGGCCACGCCGAACGGAAACCTATCGCTGGAGGAGGAAAACCGCCAGCT
AAAGGATGCACGCTTATGCAAGGTATGCTTGGACGAGGAGGTTGGCGTAG
TGTTCCTGCCCTGTGGCCACTTGGCCACCTGCAATCAGTGCGCCCCCAGT
GTAGCCAATTGTCCCATGTGCCGCGCAGACATCAAGGGATTCGTGCGCAC
GTTCCTTTCGGCAAGCTTTCTAGACCAT

BO08865.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:57:49
Subject Length Description Subject Range Query Range Score Percent Strand
Diap2-RB 1497 CG8293-PB 1..1494 17..1510 7470 100 Plus
Diap2-RA 1497 CG8293-PA 1..1494 17..1510 7470 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
Diap2-RB 1997 CG8293-RB 39..1532 17..1510 7470 100 Plus
Diap2-RA 2106 CG8293-RA 148..1641 17..1510 7470 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:57:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15932784..15933820 1424..388 5185 100 Minus
2R 25286936 2R 15934199..15934570 388..17 1860 100 Minus
2R 25286936 2R 15932635..15932721 1510..1424 435 100 Minus
Blast to na_te.dros performed on 2014-11-27 12:57:48 has no hits.

BO08865.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:09:50 Download gff for BO08865.complete
Subject Subject Range Query Range Percent Splice Strand
Iap2-RB 1..1497 17..1513 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:30:03 Download gff for BO08865.complete
Subject Subject Range Query Range Percent Splice Strand
Iap2-RB 39..1537 17..1515 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:47:26 Download gff for BO08865.complete
Subject Subject Range Query Range Percent Splice Strand
Iap2-RA 148..1641 17..1512 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:09:50 Download gff for BO08865.complete
Subject Subject Range Query Range Percent Splice Strand
Iap2-RB 39..1537 17..1515 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:08:11 Download gff for BO08865.complete
Subject Subject Range Query Range Percent Splice Strand
Diap2-RA 148..1641 17..1512 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:08:11 Download gff for BO08865.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15934199..15934570 17..388 100   Minus
2R 15932784..15933819 389..1424 100 <- Minus
2R 15932632..15932720 1425..1512 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:47:26 Download gff for BO08865.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11821704..11822075 17..388 100   Minus
arm_2R 11820289..11821324 389..1424 100 <- Minus
arm_2R 11820137..11820225 1425..1512 97 <- Minus

BO08865.pep Sequence

Translation from 16 to 1528

> BO08865.pep
MTELGMELESVRLATFGEWPLNAPVSAEDLVANGFFATGNWLEAECHFCH
VRIDRWEYGDQVAERHRRSSPICSMVLAPNHCGNVPRSQESDNEGNSVVD
SPESCSCPDLLLEANRLVTFKDWPNPNITPQALAKAGFYYLNRLDHVKCV
WCNGVIAKWEKNDNAFEEHKRFFPQCPRVQMGPLIEFATGKNLDELGIQP
TTLPLRPKYACVDARLRTFTDWPISNIQPASALAQAGLYYQKIGDQVRCF
HCNIGLRSWQKEDEPWFEHAKWSPKCQFVLLAKGPAYVSEVLATTAANAS
SQPATAPAPTLQADVLMDEAPAKEALALGIDGGVVRNAIQRKLLSSGCAF
STLDELLHDIFDDAGAGAALEVREPPEPSAPFIEPCQATTSKAASVPIPV
ADSIPAKPQAAEAVANISKITDEIQKMSVATPNGNLSLEEENRQLKDARL
CKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFVRTFLSAS
FLDH

BO08865.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
Diap2-PB 498 CG8293-PB 1..498 1..498 2670 100 Plus
Diap2-PA 498 CG8293-PA 1..498 1..498 2670 100 Plus
Diap1-PF 438 CG12284-PF 44..438 9..498 403 28.6 Plus
Diap1-PE 438 CG12284-PE 44..438 9..498 403 28.6 Plus
Diap1-PD 438 CG12284-PD 44..438 9..498 403 28.6 Plus