Clone BO08866 Report

Search the DGRC for BO08866

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:88
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptCG4973-RA
Protein status:BO08866.pep: validated full length
Sequenced Size:1105

Clone Sequence Records

BO08866.3prime Sequence

936 bp (830 high quality bases) assembled on 2006-01-10

> BO08866.3prime
ATGGTCTAGAAAGCTTGCATCACTATCATCCGAAGAAATCTCCTGAGCTT
CCTCCCCTGCTTCCGCTTTATCCTCCTTTTTCCCAAATTCCTCCTCCTCA
TCACTATCTGAGTTTTCCATTGGGTTTGTCTTGAGGCGAGCTATCAGCTC
TTTGGCGGGATTGAAAATACCATTTGTTTGCTGGGAACAGATGATGCAGC
GCTGTGACTTTTTGTACTGGGCCAAGGCGCACTTTTCACAGAAATAGTGC
TTGCACTTTGTTACCACGGGATTGACAAAACTCTGTCGGCAGATGTGGCA
CTTGAAAGGCAGTGTTTCTTCATCGGAGTGAATCTCATACTTGGTATCAT
CGCCATCGGAGTCTACATCACCCGTTCGCTGATTTTCGTGATCCATTTCC
AATTGCCAGCCCGCTTTGTAATCACTGCGATCGTGCAGAAACTTACAGCT
GTCGCCAAAGCCGCAATATCCTGTTTCCTTGTAATCCTTGCATATATCCG
GCTGATAATCCCACCTGACAGTGGCCCTAAGATGGGCAGGAGCCCTAATT
GGGCCACTTCGTACCATTCCGGAGCTGGCATTCCCTGCCGCTGTATCCTG
CTTCTTGTAGTACTGCGCATAGTTGTTAATTCCGCGATAGATCTTATCGT
CCGCCTTGCCCTCCAGCTCTTCGTTGATTTTCAGAGCTCGCGCATGAATT
GCCTGCGCATCGCGATCCAATTCTGTGTCCATTTCGTTAATCGATGTAGC
TCCCTGATCTTGGGGTCCACTGGGCAGCGCCTCGCGTTTGGATTTGTACG
CAATGCCCAGTTTATCATCGTCGGAGGCTGAGGATGAGCCATCATCACCA
ACTCCCTCCCGCCTGTCTCTTTGCTTTGCTCATTGTCTTGGTGCTCTGGA
AGTTGGGATTCGTGCGCTTTCGGCGGTTCTCGGCTC

BO08866.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:30:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG4973-PA 1074 CG4973-RA 235..1071 855..19 4185 100 Minus
CG4973-PA 1074 CG4973-RA 155..236 936..855 410 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 11:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
mdlc-RA 1419 CG4973-RA 261..1177 936..19 4565 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 11:00:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20058066..20058746 936..255 3360 99.9 Minus
3R 32079331 3R 20058812..20059049 256..19 1190 100 Minus
Blast to na_te.dros performed on 2015-02-06 11:00:27 has no hits.

BO08866.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:55:37 Download gff for BO08866.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4973-PA 155..1074 15..936 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:53:33 Download gff for BO08866.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4973-PA 155..1074 15..936 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 08:31:59 Download gff for BO08866.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4973-RA 261..1180 15..936 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:41:43 Download gff for BO08866.3prime
Subject Subject Range Query Range Percent Splice Strand
mdlc-RA 261..1180 15..936 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:41:43 Download gff for BO08866.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 20058812..20059052 15..256 99   Minus
3R 20058066..20058744 257..936 99 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 08:31:59 Download gff for BO08866.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15884534..15884774 15..256 99   Minus
arm_3R 15883788..15884466 257..936 99 -> Minus

BO08866.5prime Sequence

961 bp (822 high quality bases) assembled on 2006-01-09

> BO08866.5prime
GAAGTTATCAGTCGACATGTCGGAAGAAGCGGCTAGCACCTCGTCCTTTG
GCTTCAAGAAGCGGAACCTCAAGAAGGGAGCTGGAATTCGTCGCAAAAAG
GAAACCAGCAGTGATGAATCTGCAAAAAGCAGCGATGAAGAGACCAAAGG
CAAAGCCAGTGCTCTGGTGCGAGCCGAGAACCGCCGAAAGCGCACGAATC
CCAACTTCCAGAGCACCAAGACAATGAGCAAAGCAAAGAGACAGGCGGGA
GGAGTTGGTGATGATGGCTCATCCTCAGCCTCCGACGATGATAAACTGGG
CATTGCGTACAAATCCAAACGCGAGGCGCTGCCCAGTGGACCCCAAGATC
AGGGAGCTACATCGATTAACGAAATGGACACAGAATTGGATCGCGATGCG
CAGGCAATTCATGCGCGAGCTCTGAAAATCAACGAAGAGCTGGAGGGCAA
GGCGGACGATAAGATCTATCGCGGAATTAACAACTATGCGCAGTACTACA
AGAAGCAGGATACAGCGGCAGGGAATGCCAGCTCCGGAATGGTACGAAGT
GGCCCAATTAGGGCTCCTGCCCATCTTAGGGCCACTGTCAGGTGGGATTA
TCAGCCGGATATATGCAAGGATTACAAGGAAACAGGATATTGCGGCTTTG
GCGACAGCTGTAAGTTTCTGCACGATCGCAGTGATTACAAAGCGGGCTGG
CAATTGGAAATGGATCACGAAAATCAGCGAACGGGTGATGTAGACTCCGA
TGGCGATGATACCAAGTATGAGATTCACTCCGATGAAGAAACACTGCCTT
TCAAGTGCCACATCTGCCGACAGAGTTTTGTCAATCCCGTGGTAACAAAG
TGCAAGCACTATTTCTGTGAAAAGTGCGCCTTGGCCCAGTACAAAAAGTC
ACAGCGCTGCATCATCTGTTCCCAGCAAACAAATGGTATTTTCAATCCCG
CCAAAGAGCTG

BO08866.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:30:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG4973-PA 1074 CG4973-RA 1..945 17..961 4725 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:11:04
Subject Length Description Subject Range Query Range Score Percent Strand
mdlc-RA 1419 CG4973-RA 107..1051 17..961 4725 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:10:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20058017..20058746 122..851 3650 100 Plus
3R 32079331 3R 20058812..20058923 850..961 560 100 Plus
3R 32079331 3R 20057854..20057959 17..122 530 100 Plus
Blast to na_te.dros performed on 2015-02-11 23:10:59 has no hits.

BO08866.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:55:38 Download gff for BO08866.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4973-PA 1..945 17..961 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:53:35 Download gff for BO08866.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4973-PA 1..945 17..961 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 19:53:04 Download gff for BO08866.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4973-RA 105..1051 14..961 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:48:53 Download gff for BO08866.5prime
Subject Subject Range Query Range Percent Splice Strand
mdlc-RA 105..1051 14..961 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:48:53 Download gff for BO08866.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 20058812..20058923 850..961 100   Plus
3R 20058018..20058744 123..849 100 -> Plus
3R 20057852..20057959 14..122 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 19:53:04 Download gff for BO08866.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15884534..15884645 850..961 100   Plus
arm_3R 15883740..15884466 123..849 100 -> Plus
arm_3R 15883574..15883681 14..122 99 -> Plus

BO08866.complete Sequence

1105 bp (1105 high quality bases) assembled on 2006-01-18

GenBank Submission: FJ631296

> BO08866.complete
GAAGTTATCAGTCGACATGTCGGAAGAAGCGGCTAGCACCTCGTCCTTTG
GCTTCAAGAAGCGGAACCTCAAGAAGGGAGCTGGAATTCGTCGCAAAAAG
GAAACCAGCAGTGATGAATCTGCAAAAAGCAGCGATGAAGAGACCAAAGG
CAAAGCCAGTGCTCTGGTGCGAGCCGAGAACCGCCGAAAGCGCACGAATC
CCAACTTCCAGAGCACCAAGACAATGAGCAAAGCAAAGAGACAGGCGGGA
GGAGTTGGTGATGATGGCTCATCCTCAGCCTCCGACGATGATAAACTGGG
CATTGCGTACAAATCCAAACGCGAGGCGCTGCCCAGTGGACCCCAAGATC
AGGGAGCTACATCGATTAACGAAATGGACACAGAATTGGATCGCGATGCG
CAGGCAATTCATGCGCGAGCTCTGAAAATCAACGAAGAGCTGGAGGGCAA
GGCGGACGATAAGATCTATCGCGGAATTAACAACTATGCGCAGTACTACA
AGAAGCAGGATACAGCGGCAGGGAATGCCAGCTCCGGAATGGTACGAAGT
GGCCCAATTAGGGCTCCTGCCCATCTTAGGGCCACTGTCAGGTGGGATTA
TCAGCCGGATATATGCAAGGATTACAAGGAAACAGGATATTGCGGCTTTG
GCGACAGCTGTAAGTTTCTGCACGATCGCAGTGATTACAAAGCGGGCTGG
CAATTGGAAATGGATCACGAAAATCAGCGAACGGGTGATGTAGACTCCGA
TGGCGATGATACCAAGTATGAGATTCACTCCGATGAAGAAACACTGCCTT
TCAAGTGCCACATCTGCCGACAGAGTTTTGTCAATCCCGTGGTAACAAAG
TGCAAGCACTATTTCTGTGAAAAGTGCGCCTTGGCCCAGTACAAAAAGTC
ACAGCGCTGCATCATCTGTTCCCAGCAAACAAATGGTATTTTCAATCCCG
CCAAAGAGCTGATAGCTCGCCTCAAGACAAACCCAATGGAAAACTCAGAT
AGTGATGAGGAGGAGGAATTTGGGAAAAAGGAGGATAAAGCGGAAGCAGG
GGAGGAAGCTCAGGAGATTTCTTCGGATGATAGTGATGCAAGCTTTCTAG
ACCAT

BO08866.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
mdlc-RA 1074 CG4973-PA 1..1071 17..1087 5355 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
mdlc-RA 1419 CG4973-RA 107..1177 17..1087 5355 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20058017..20058746 122..851 3650 100 Plus
3R 32079331 3R 20058812..20059049 850..1087 1190 100 Plus
3R 32079331 3R 20057854..20057959 17..122 530 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:04:46 has no hits.

BO08866.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:09:52 Download gff for BO08866.complete
Subject Subject Range Query Range Percent Splice Strand
CG4973-RA 1..1074 17..1091 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:30:06 Download gff for BO08866.complete
Subject Subject Range Query Range Percent Splice Strand
CG4973-RA 103..1178 14..1091 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:15:22 Download gff for BO08866.complete
Subject Subject Range Query Range Percent Splice Strand
CG4973-RA 107..1177 17..1089 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:09:52 Download gff for BO08866.complete
Subject Subject Range Query Range Percent Splice Strand
CG4973-RA 103..1178 14..1091 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:12:24 Download gff for BO08866.complete
Subject Subject Range Query Range Percent Splice Strand
mdlc-RA 107..1177 17..1089 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:12:24 Download gff for BO08866.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20058812..20059049 850..1089 99   Plus
3R 20058018..20058744 123..849 100 -> Plus
3R 20057854..20057959 17..122 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:15:22 Download gff for BO08866.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15884534..15884771 850..1089 99   Plus
arm_3R 15883740..15884466 123..849 100 -> Plus
arm_3R 15883576..15883681 17..122 100 -> Plus

BO08866.pep Sequence

Translation from 16 to 1105

> BO08866.pep
MSEEAASTSSFGFKKRNLKKGAGIRRKKETSSDESAKSSDEETKGKASAL
VRAENRRKRTNPNFQSTKTMSKAKRQAGGVGDDGSSSASDDDKLGIAYKS
KREALPSGPQDQGATSINEMDTELDRDAQAIHARALKINEELEGKADDKI
YRGINNYAQYYKKQDTAAGNASSGMVRSGPIRAPAHLRATVRWDYQPDIC
KDYKETGYCGFGDSCKFLHDRSDYKAGWQLEMDHENQRTGDVDSDGDDTK
YEIHSDEETLPFKCHICRQSFVNPVVTKCKHYFCEKCALAQYKKSQRCII
CSQQTNGIFNPAKELIARLKTNPMENSDSDEEEEFGKKEDKAEAGEEAQE
ISSDDSDASFLDH

BO08866.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
mdlc-PA 357 CG4973-PA 1..357 1..357 1880 100 Plus