Clone BO08882 Report

Search the DGRC for BO08882

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:88
Well:82
Vector:pDNR-Dual
Associated Gene/TranscriptArp66B-RA
Protein status:BO08882.pep: validated full length
Sequenced Size:1288

Clone Sequence Records

BO08882.3prime Sequence

926 bp (804 high quality bases) assembled on 2006-01-10

> BO08882.3prime
ATGGTCTAGAAAGCTTGCTGTCATGGTGCCAAAGACGGGATTGTGACGGC
AAATGCTGGGGCCATACTCCTCGTAGGCAGCCTTCGTGTGACACACCTGA
TAGAACTCGGGCGTTGAAGCCAACATGCTGCCTCCAAACCACACGGCGTA
CCTCTGCATGTGGTGCGTAATCACCTGAACATCAATGGGTTTTGGCTTAA
TGCGTCCCTCGGACAAATTCTCGCTGATCCGGAGACGTGTGTCCACCGAT
CGCTTGATATCTCGCTGCAACCTCCTGCCGAAGTCCTTGAACATCGTTGA
TCCACCGCTCAGAACAATGTTATTGTATAGAGGACGCCGCACATCGATTG
GGCAGTTTTGGATGACATTATCCACTATTTCCGACAGTGGAATGGTAAAG
TCGGGGTTTGAGAACTCGGGATGGAAGAAGATCTCGGGTCCCAGGAATCG
CTCGTAGCCCACGTCCACATTGAACGGCGCCTTGGTTACCGTGTTAACGC
CGCTAAAGTTGCGTATCCACTTGCCCGGCTCCGTGTCGTACTTGGCAAAT
TCTTTGGCGATATCGGGACAGATGTAGCAGTGCTTCTCCTTGATCGCTTT
AGCAGTCTCGAGGCTCTGTTCCGGCGGAATGCCCACCTCCCGTTCGCGTA
GCAGGCTCTGGATGAACGAGGTGATATTGCGGCCCGCGATGGGAATGTGC
TTGATGCAGGAGCCGATCACATAGCCCTCGGCCACGGGTATGACGTGCGT
CACTCCATCGCCGCTGTCCACCACGATGCCTGTAAGGGTACGCTCCTCTG
CGGACCGGGAGGCCCAACTGGCGGCTAGGGCAAGCACCGCCTGGACGGCG
ATATACAGACCAGGAACGTTGAACGTCTCAAACATTATCTCCGCGGTGTA
CTCCCGATTTTCGGGCGTATTTAGCG

BO08882.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:31:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG7558-PA 1257 Arp66B-RA 347..1254 926..19 4540 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
Arp3-RB 1585 CG7558-RB 524..1431 926..19 4540 100 Minus
Arp3-RA 1983 CG7558-RA 524..1431 926..19 4540 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 18:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8114257..8114794 196..733 2690 100 Plus
3L 28110227 3L 8115029..8115223 732..926 975 100 Plus
3L 28110227 3L 8113959..8114052 19..112 470 100 Plus
3L 28110227 3L 8114113..8114198 112..197 430 100 Plus
Blast to na_te.dros performed on 2015-02-12 18:18:37 has no hits.

BO08882.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:56:02 Download gff for BO08882.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7558-PA 347..1257 15..926 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:54:10 Download gff for BO08882.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7558-PA 347..1257 15..926 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 04:12:14 Download gff for BO08882.3prime
Subject Subject Range Query Range Percent Splice Strand
Arp3-RA 524..1436 11..926 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 20:24:46 Download gff for BO08882.3prime
Subject Subject Range Query Range Percent Splice Strand
Arp3-RA 524..1436 11..926 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 20:24:46 Download gff for BO08882.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 8115030..8115223 733..926 100   Plus
3L 8114257..8114793 196..732 100 <- Plus
3L 8114113..8114196 112..195 100 <- Plus
3L 8113954..8114051 11..111 96 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 04:12:14 Download gff for BO08882.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8108130..8108323 733..926 100   Plus
arm_3L 8107357..8107893 196..732 100 <- Plus
arm_3L 8107213..8107296 112..195 100 <- Plus
arm_3L 8107054..8107151 11..111 96 <- Plus

BO08882.5prime Sequence

847 bp (815 high quality bases) assembled on 2006-01-09

> BO08882.5prime
GAAGTTATCAGTCGACATGGCAGGCAGGCTACCGGCATGCGTAATCGATG
TGGGCACCGGCTACTCCAAACTGGGATTTGCCGGGAATAAAGAGCCGCAG
TTCATTATTCCCTCGGCGATTGCCATCAAGGAGTCGGCACGAGTGGGAGA
CACCAACACACGGCGCATCACAAAGGGCATCGAGGACCTGGACTTCTTCA
TCGGCGATGAGGCCTTCGATGCCACCGGCTACTCCATCAAGTATCCGGTG
CGTCATGGTCTGGTGGAGGACTGGGACTTGATGGAGCGCTTTCTGGAGCA
GTGCGTCTTTAAGTATCTGCGCGCCGAGCCTGAGGATCACTACTTCCTGC
TGACTGAGCCGCCGCTAAATACGCCCGAAAATCGGGAGTACACCGCGGAG
ATAATGTTTGAGACGTTCAACGTTCCTGGTCTGTATATCGCCGTCCAGGC
GGTGCTTGCCCTAGCCGCCAGTTGGGCCTCCCGGTCCGCAGAGGAGCGTA
CCCTTACAGGCATCGTGGTGGACAGCGGCGATGGAGTGACGCACGTCATA
CCCGTGGCCGAGGGCTATGTGATCGGCTCCTGCATCAAGCACATTCCCAT
CGCGGGCCGCAATATCACCTCGTTCATCCAGAGCCTGCTACGCGAACGGG
AGGTGGGCATTCCGCCGGAACAGAGCCTCGAGACTGCTAAAGCGATCAAG
GAGAAGCACTGCTACATCTGTCCCGATATCGCCAAAGAATTTGCCAAGTA
CGACACGGAGCCGGGCAAGTGGATACGCAACTTTAGCGGCGTTAACACGG
TAACCAAGGCGCCGTTCAATGTGGACGTGGGCTACGAGCGATTCCTG

BO08882.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG7558-PA 1257 Arp66B-RA 1..831 17..847 4155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Arp3-RB 1585 CG7558-RB 177..1008 16..847 4160 100 Plus
Arp3-RA 1983 CG7558-RA 177..1008 16..847 4160 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8115029..8115346 557..240 1590 100 Minus
3L 28110227 3L 8114503..8114794 847..556 1460 100 Minus
3L 28110227 3L 8115408..8115589 241..60 910 100 Minus
3L 28110227 3L 8115682..8115726 60..16 225 100 Minus
Blast to na_te.dros performed on 2015-02-11 23:10:32 has no hits.

BO08882.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:56:03 Download gff for BO08882.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7558-PA 1..831 17..847 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:54:12 Download gff for BO08882.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7558-PA 1..831 17..847 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 19:53:02 Download gff for BO08882.5prime
Subject Subject Range Query Range Percent Splice Strand
Arp3-RA 170..1008 9..847 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:48:50 Download gff for BO08882.5prime
Subject Subject Range Query Range Percent Splice Strand
Arp3-RA 170..1008 9..847 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:48:50 Download gff for BO08882.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 8115682..8115733 9..60 96   Minus
3L 8115408..8115588 61..241 100 <- Minus
3L 8115030..8115344 242..556 100 <- Minus
3L 8114503..8114793 557..847 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 19:53:02 Download gff for BO08882.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8108782..8108833 9..60 96   Minus
arm_3L 8108508..8108688 61..241 100 <- Minus
arm_3L 8108130..8108444 242..556 100 <- Minus
arm_3L 8107603..8107893 557..847 100 <- Minus

BO08882.complete Sequence

1288 bp (1288 high quality bases) assembled on 2006-01-18

GenBank Submission: FJ631300

> BO08882.complete
GAAGTTATCAGTCGACATGGCAGGCAGGCTACCGGCATGCGTAATCGATG
TGGGCACCGGCTACTCCAAACTGGGATTTGCCGGGAATAAAGAGCCGCAG
TTCATTATTCCCTCGGCGATTGCCATCAAGGAGTCGGCACGAGTGGGAGA
CACCAACACACGGCGCATCACAAAGGGCATCGAGGACCTGGACTTCTTCA
TCGGCGATGAGGCCTTCGATGCCACCGGCTACTCCATCAAGTATCCGGTG
CGTCATGGTCTGGTGGAGGACTGGGACTTGATGGAGCGCTTTCTGGAGCA
GTGCGTCTTTAAGTATCTGCGCGCCGAGCCTGAGGATCACTACTTCCTGC
TGACTGAGCCGCCGCTAAATACGCCCGAAAATCGGGAGTACACCGCGGAG
ATAATGTTTGAGACGTTCAACGTTCCTGGTCTGTATATCGCCGTCCAGGC
GGTGCTTGCCCTAGCCGCCAGTTGGGCCTCCCGGTCCGCAGAGGAGCGTA
CCCTTACAGGCATCGTGGTGGACAGCGGCGATGGAGTGACGCACGTCATA
CCCGTGGCCGAGGGCTATGTGATCGGCTCCTGCATCAAGCACATTCCCAT
CGCGGGCCGCAATATCACCTCGTTCATCCAGAGCCTGCTACGCGAACGGG
AGGTGGGCATTCCGCCGGAACAGAGCCTCGAGACTGCTAAAGCGATCAAG
GAGAAGCACTGCTACATCTGTCCCGATATCGCCAAAGAATTTGCCAAGTA
CGACACGGAGCCGGGCAAGTGGATACGCAACTTTAGCGGCGTTAACACGG
TAACCAAGGCGCCGTTCAATGTGGACGTGGGCTACGAGCGATTCCTGGGA
CCCGAGATCTTCTTCCATCCCGAGTTCTCAAACCCCGACTTTACCATTCC
ACTGTCGGAAATAGTGGATAATGTCATCCAAAACTGCCCAATCGATGTGC
GGCGTCCTCTATACAATAACATTGTTCTGAGCGGTGGATCAACGATGTTC
AAGGACTTCGGCAGGAGGTTGCAGCGAGATATCAAGCGATCGGTGGACAC
ACGTCTCCGGATCAGCGAGAATTTGTCCGAGGGACGCATTAAGCCAAAAC
CCATTGATGTTCAGGTGATTACGCACCACATGCAGAGGTACGCCGTGTGG
TTTGGAGGCAGCATGTTGGCTTCAACGCCCGAGTTCTATCAGGTGTGTCA
CACGAAGGCTGCCTACGAGGAGTATGGCCCCAGCATTTGCCGTCACAATC
CCGTCTTTGGCACCATGACAGCAAGCTTTCTAGACCAT

BO08882.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
Arp3-RB 1257 CG7558-PB 1..1254 17..1270 6270 100 Plus
Arp3-RA 1257 CG7558-PA 1..1254 17..1270 6270 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
Arp3-RB 1585 CG7558-RB 177..1431 16..1270 6275 100 Plus
Arp3-RA 1983 CG7558-RA 177..1431 16..1270 6275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:25:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8114257..8114794 1093..556 2690 100 Minus
3L 28110227 3L 8115029..8115346 557..240 1590 100 Minus
3L 28110227 3L 8115408..8115589 241..60 910 100 Minus
3L 28110227 3L 8113959..8114052 1270..1177 470 100 Minus
3L 28110227 3L 8114113..8114198 1177..1092 430 100 Minus
3L 28110227 3L 8115682..8115726 60..16 225 100 Minus
Blast to na_te.dros performed on 2014-11-28 00:25:31 has no hits.

BO08882.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:09:41 Download gff for BO08882.complete
Subject Subject Range Query Range Percent Splice Strand
Arp66B-RA 1..1257 17..1274 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:29:53 Download gff for BO08882.complete
Subject Subject Range Query Range Percent Splice Strand
Arp66B-RA 168..1434 9..1278 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:24:20 Download gff for BO08882.complete
Subject Subject Range Query Range Percent Splice Strand
Arp3-RA 178..1431 17..1272 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:09:41 Download gff for BO08882.complete
Subject Subject Range Query Range Percent Splice Strand
Arp66B-RA 168..1434 9..1278 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:31:38 Download gff for BO08882.complete
Subject Subject Range Query Range Percent Splice Strand
Arp3-RA 178..1431 17..1272 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:31:38 Download gff for BO08882.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8115682..8115725 17..60 100   Minus
3L 8115408..8115588 61..241 100 <- Minus
3L 8115030..8115344 242..556 100 <- Minus
3L 8114257..8114793 557..1093 100 <- Minus
3L 8114113..8114196 1094..1177 100 <- Minus
3L 8113957..8114051 1178..1272 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:24:20 Download gff for BO08882.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8108782..8108825 17..60 100   Minus
arm_3L 8108508..8108688 61..241 100 <- Minus
arm_3L 8108130..8108444 242..556 100 <- Minus
arm_3L 8107357..8107893 557..1093 100 <- Minus
arm_3L 8107213..8107296 1094..1177 100 <- Minus
arm_3L 8107057..8107151 1178..1272 97 <- Minus

BO08882.pep Sequence

Translation from 16 to 1288

> BO08882.pep
MAGRLPACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRR
ITKGIEDLDFFIGDEAFDATGYSIKYPVRHGLVEDWDLMERFLEQCVFKY
LRAEPEDHYFLLTEPPLNTPENREYTAEIMFETFNVPGLYIAVQAVLALA
ASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNI
TSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPG
KWIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIV
DNVIQNCPIDVRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRIS
ENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKAAY
EEYGPSICRHNPVFGTMTASFLDH

BO08882.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:42:50
Subject Length Description Subject Range Query Range Score Percent Strand
Arp3-PB 418 CG7558-PB 1..418 1..418 2211 100 Plus
Arp3-PA 418 CG7558-PA 1..418 1..418 2211 100 Plus
Act87E-PC 376 CG18290-PC 8..370 7..407 648 35.8 Plus
Act87E-PB 376 CG18290-PB 8..370 7..407 648 35.8 Plus
Act87E-PA 376 CG18290-PA 8..370 7..407 648 35.8 Plus