Clone BO08909 Report

Search the DGRC for BO08909

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:89
Well:9
Vector:pDNR-Dual
Associated Gene/TranscriptAP-47-RA
Protein status:BO08909.pep: validated full length
Sequenced Size:1312

Clone Sequence Records

BO08909.3prime Sequence

881 bp (838 high quality bases) assembled on 2006-01-10

> BO08909.3prime
ATGGTCTAGAAAGCTTGCATTGGTGCGTAGCTGATAGTCGCCGTTCTGCG
TGATGTACCGCACCCATGGCAGCGCCTGATAGCCGCTCTTCTCGATGATC
TTCAGATAGCGCACCTGGATGCCCGACGTGGTAAAGTAGGGAATCTCGAA
GCGCACCTGAATTGGCGGCTTGCCCTCCGTATTGTCCTCGCTTTCCACGC
TCGGCAGACCGAAATGTGCCCGCATTAGATACTCCTTGCCACCCGGGAAC
GATTTGATCGTCCAGATGATTGCGTTCTGCTCCGGTGCGTACTTGCAGCT
TCCAATGGTGGTCTTGAACTTGGGTGAGTCCGCGTCGGCGGGCACTGGTA
TGACGATTTCCACGTTGTTGGCCGTCGATCTTCGCTTGAACTGAGACTTC
GCCTTAATCATGTACTCCACACGGGAGTGGGCATGCCGCTCGATCACTGA
TTCGATCCAAATCAGGGGTTTGACATGCGTGTTCAGACGATAGGACATCA
GTTCGAACTCGCCGTCCGGAGGAATGAACGAGATTGTCCGGTCATTCTCG
AAGCGTGACAACCGCACGCACTGGTGGAACTTGACGTCCTCCAGCTCTAC
GGACTTTGACTTGCCGCGGCCCGTGCTCTCGAACAGAACCTTGTCGTTGA
GACCCAGTCGCAGCTCTGGCATTCCCGACAAGTAGACGCGCATCTTAATG
GCGCCCACGATCTCGCTGCGCAGCACATTGCCATTGGCGTTTGCGAGAAG
ATTCACCGACTCGATAACGTCCAGGAACACCTCGTTCTTGCGATACTTAA
TGCCCTCGGACCGCCAGGATACTGCATTGGTCACGGCCACCGGGATGCGG
GGCTGTAGCTCCAGCTTATGACCCTCCTGCG

BO08909.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:31:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG9388-PA 1281 AP-47-RA 416..1278 881..19 4315 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 11:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1mu-RA 1755 CG9388-RA 692..1554 881..19 4315 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 11:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9557913..9558368 19..474 2280 100 Plus
3R 32079331 3R 9558426..9558834 473..881 2045 100 Plus
Blast to na_te.dros performed on 2015-02-11 11:33:22 has no hits.

BO08909.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:56:40 Download gff for BO08909.3prime
Subject Subject Range Query Range Percent Splice Strand
AP-47-PA 416..1281 16..881 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:55:05 Download gff for BO08909.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9388-PA 416..1281 16..881 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 07:53:36 Download gff for BO08909.3prime
Subject Subject Range Query Range Percent Splice Strand
AP-1mu-RA 692..1560 14..881 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:51:26 Download gff for BO08909.3prime
Subject Subject Range Query Range Percent Splice Strand
AP-1mu-RA 692..1560 14..881 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:51:26 Download gff for BO08909.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 9558428..9558834 475..881 100   Plus
3R 9557907..9558368 14..474 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 07:53:36 Download gff for BO08909.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5384150..5384556 475..881 100   Plus
arm_3R 5383629..5384090 14..474 99 <- Plus

BO08909.5prime Sequence

906 bp (764 high quality bases) assembled on 2006-01-10

> BO08909.5prime
GAAGTTATCAGTCGACATGTCTTCGTCGGCCATTTTCGTTCTGGACGTGA
AGGGCAAGGTGCTGATATCGCGGAACTACCGCGGTGACAACATCGACATG
GCCGTGATCGACAAATTCATGCCATTGCTGATGGAGCGCGAGGAGGAGGG
CCTAATCACTCCGATCCTTCAGACGGCGGAGACTACATTTGCCTACATCA
AAACGAACAATCTTTATATCGTATCCACGACGCCGCGCAATAAGAACGTT
AATATCGCTCTGGTCTTCGTCTTTCTGCACAAGATCGCGCAGGTCTTTGT
GGAATACTTCAAGGAGCTGGAGGAGGAGTCCATTCGGGACAATTTCGTGA
TCATCTACGAGCTGCTGGATGAATTGCTCGACTTTGGCTACCCGCAGACC
ACCGACTCGAAAATTCTACAGGAATACATTACGCAGGAGGGTCATAAGCT
GGAGCTACAGCCCCGCATCCCGGTGGCCGTGACCAATGCAGTATCCTGGC
GGTCCGAGGGCATTAAGTATCGCAAGAACGAGGTGTTCCTGGACGTTATC
GAGTCGGTGAATCTTCTCGCAAACGCCAATGGCAATGTGCTGCGCAGCGA
GATCGTGGGCGCCATTAAGATGCGCGTCTACTTGTCGGGAATGCCAGAGC
TGCGACTGGGTCTCAACGACAAGGTTCTGTTCGAGAGCACGGGCCGCGGC
AAGTCAAAGTCCGTAGAGCTGGAGGACGTCAAGTTCCACCAGTGCGTGCG
GTTGTCACGCTTCGAGAATGACCGGACAATCTCGTTCATTCCTCCGGACG
GCGAGTTCGAACTGATGTCCTATCGTCTGAACACGCATGTCAAACCCCTG
ATTTGGATCGAATCAGTGATCGAAGCGCATGCCCACTCCCGTGTGGAGTA
CATGAT

BO08909.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:31:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG9388-PA 1281 AP-47-RA 1..857 17..873 4285 100 Plus
CG9388-PA 1281 AP-47-RA 861..890 877..906 150 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1mu-RA 1755 CG9388-RA 274..1166 14..906 4420 99.8 Plus
AP-2mu-RC 1976 CG7057-RC 461..525 344..408 235 90.8 Plus
AP-2mu-RB 2025 CG7057-RB 461..525 344..408 235 90.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 01:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9558426..9559252 840..14 4135 100 Minus
3R 32079331 3R 9558301..9558368 906..839 295 95.6 Minus
3R 32079331 3R 22462983..22463047 344..408 235 90.8 Plus
Blast to na_te.dros performed on 2015-02-12 01:52:59 has no hits.

BO08909.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:56:41 Download gff for BO08909.5prime
Subject Subject Range Query Range Percent Splice Strand
AP-47-PA 1..890 17..906 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:55:06 Download gff for BO08909.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9388-PA 1..890 17..906 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 19:52:36 Download gff for BO08909.5prime
Subject Subject Range Query Range Percent Splice Strand
AP-1mu-RA 271..1166 10..906 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:56:07 Download gff for BO08909.5prime
Subject Subject Range Query Range Percent Splice Strand
AP-1mu-RA 271..1166 10..906 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 06:56:07 Download gff for BO08909.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 9558428..9559255 10..838 99   Minus
3R 9558301..9558368 839..906 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 19:52:36 Download gff for BO08909.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5384150..5384977 10..838 99   Minus
arm_3R 5384023..5384090 839..906 97 <- Minus

BO08909.complete Sequence

1312 bp (1312 high quality bases) assembled on 2006-01-18

GenBank Submission: FJ631312

> BO08909.complete
GAAGTTATCAGTCGACATGTCTTCGTCGGCCATTTTCGTTCTGGACGTGA
AGGGCAAGGTGCTGATATCGCGGAACTACCGCGGTGACAACATCGACATG
GCCGTGATCGACAAATTCATGCCATTGCTGATGGAGCGCGAGGAGGAGGG
CCTAATCACTCCGATCCTTCAGACGGCGGAGACTACATTTGCCTACATCA
AAACGAACAATCTTTATATCGTATCCACGACGCCGCGCAATAAGAACGTT
AATATCGCTCTGGTCTTCGTCTTTCTGCACAAGATCGCGCAGGTCTTTGT
GGAATACTTCAAGGAGCTGGAGGAGGAGTCCATTCGGGACAATTTCGTGA
TCATCTACGAGCTGCTGGATGAATTGCTCGACTTTGGCTACCCGCAGACC
ACCGACTCGAAAATTCTACAGGAATACATTACGCAGGAGGGTCATAAGCT
GGAGCTACAGCCCCGCATCCCGGTGGCCGTGACCAATGCAGTATCCTGGC
GGTCCGAGGGCATTAAGTATCGCAAGAACGAGGTGTTCCTGGACGTTATC
GAGTCGGTGAATCTTCTCGCAAACGCCAATGGCAATGTGCTGCGCAGCGA
GATCGTGGGCGCCATTAAGATGCGCGTCTACTTGTCGGGAATGCCAGAGC
TGCGACTGGGTCTCAACGACAAGGTTCTGTTCGAGAGCACGGGCCGCGGC
AAGTCAAAGTCCGTAGAGCTGGAGGACGTCAAGTTCCACCAGTGCGTGCG
GTTGTCACGCTTCGAGAATGACCGGACAATCTCGTTCATTCCTCCGGACG
GCGAGTTCGAACTGATGTCCTATCGTCTGAACACGCATGTCAAACCCCTG
ATTTGGATCGAATCAGTGATCGAGCGGCATGCCCACTCCCGTGTGGAGTA
CATGATTAAGGCGAAGTCTCAGTTCAAGCGAAGATCGACGGCCAACAACG
TGGAAATCGTCATACCAGTGCCCGCCGACGCGGACTCACCCAAGTTCAAG
ACCACCATTGGAAGCTGCAAGTACGCACCGGAGCAGAACGCAATCATCTG
GACGATCAAATCGTTCCCGGGTGGCAAGGAGTATCTAATGCGGGCACATT
TCGGTCTGCCGAGCGTGGAAAGCGAGGACAATACGGAGGGCAAGCCGCCA
ATTCAGGTGCGCTTCGAGATTCCCTACTTTACCACGTCGGGCATCCAGGT
GCGCTATCTGAAGATCATCGAGAAGAGCGGCTATCAGGCGCTGCCATGGG
TGCGGTACATCACGCAGAACGGCGACTATCAGCTACGCACCAATGCAAGC
TTTCTAGACCAT

BO08909.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:42:41
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1mu-RA 1281 CG9388-PA 1..1278 17..1294 6390 100 Plus
AP-2mu-RC 1314 CG7057-PC 313..377 344..408 235 90.8 Plus
AP-2mu-RB 1314 CG7057-PB 313..377 344..408 235 90.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:42:42
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1mu-RA 1755 CG9388-RA 274..1554 14..1294 6405 100 Plus
AP-2mu-RC 1976 CG7057-RC 461..525 344..408 235 90.8 Plus
AP-2mu-RB 2025 CG7057-RB 461..525 344..408 235 90.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9558426..9559252 840..14 4135 100 Minus
3R 32079331 3R 9557913..9558368 1294..839 2280 100 Minus
3R 32079331 3R 22462983..22463047 344..408 235 90.8 Plus
Blast to na_te.dros performed on 2014-11-27 15:42:40 has no hits.

BO08909.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:09:37 Download gff for BO08909.complete
Subject Subject Range Query Range Percent Splice Strand
AP-47-RA 1..1281 17..1297 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:29:48 Download gff for BO08909.complete
Subject Subject Range Query Range Percent Splice Strand
AP-47-RA 269..1558 10..1299 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:48:50 Download gff for BO08909.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1mu-RA 277..1554 17..1296 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:09:38 Download gff for BO08909.complete
Subject Subject Range Query Range Percent Splice Strand
AP-47-RA 269..1558 10..1299 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:14:33 Download gff for BO08909.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1mu-RA 277..1554 17..1296 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:14:33 Download gff for BO08909.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9558428..9559249 17..838 100   Minus
3R 9557910..9558368 839..1296 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:48:50 Download gff for BO08909.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5384150..5384971 17..838 100   Minus
arm_3R 5383632..5384090 839..1296 99 <- Minus

BO08909.pep Sequence

Translation from 16 to 1312

> BO08909.pep
MSSSAIFVLDVKGKVLISRNYRGDNIDMAVIDKFMPLLMEREEEGLITPI
LQTAETTFAYIKTNNLYIVSTTPRNKNVNIALVFVFLHKIAQVFVEYFKE
LEEESIRDNFVIIYELLDELLDFGYPQTTDSKILQEYITQEGHKLELQPR
IPVAVTNAVSWRSEGIKYRKNEVFLDVIESVNLLANANGNVLRSEIVGAI
KMRVYLSGMPELRLGLNDKVLFESTGRGKSKSVELEDVKFHQCVRLSRFE
NDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIERHAHSRVEYMIKAK
SQFKRRSTANNVEIVIPVPADADSPKFKTTIGSCKYAPEQNAIIWTIKSF
PGGKEYLMRAHFGLPSVESEDNTEGKPPIQVRFEIPYFTTSGIQVRYLKI
IEKSGYQALPWVRYITQNGDYQLRTNASFLDH

BO08909.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1mu-PA 426 CG9388-PA 1..426 1..426 2184 100 Plus
AP-2mu-PC 437 CG7057-PC 5..436 6..424 852 42.2 Plus
AP-2mu-PB 437 CG7057-PB 5..436 6..424 852 42.2 Plus
AP-2mu-PA 437 CG7057-PA 5..436 6..424 852 42.2 Plus
cm-PB 415 CG3035-PB 4..414 5..424 450 27.4 Plus