Clone BO08945 Report

Search the DGRC for BO08945

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:89
Well:45
Vector:pDNR-Dual
Associated Gene/TranscriptArp11-RA
Protein status:BO08945.pep: validated full length
Sequenced Size:1168

Clone Sequence Records

BO08945.3prime Sequence

919 bp (858 high quality bases) assembled on 2006-01-10

> BO08945.3prime
ATGGTCTAGAAAGCTTGCCGAGCCTGTCGGCCTATTATCGCACAGGTTGC
TCCAGTCGGGAACGTGCTCGCTCTTTAGATACGTCTCCTTGACCAGCGAT
CGTGTCTGGATGAGATCCGTCGCGCCGCACAAGGCGCCGCCCAGCCAGGC
AGTAAAGTTTTGCTTGCCGACAGCATTGAAAAACTTGAACTGCAGCTCGC
CATGGAAGCGTTCGGCGTAGAACGGATCCTCGGTGAGCAGATGCTGCAGC
TCCTGGCGGAGGCGGGCCAGCAGACCCTGGACCATTGAGCCGCCGCCCAC
GAGGAACACACTCTCGACCAGGGCACGTCGCACGTCTAGTGTGCAGTCGA
GAATGGAGCGCAGGATGAGATGCGGCAGGCTGTCCCGCTCGTTGCTGGCC
TCGAACATGATCTCGTAGGCAGACTCCCGCAGGAGGCCGGGCACCTGGAT
GACCGCATCGTTGTCGCTGACAATGTAGTCCACGTCTGGCGCGGGAGTCG
GCTGATTCTCGTCGCCGTTGGCGCGGGCCTTGGCTCTTTCCATGGTGGTC
ACAAAGCAGGTTCGCACCTTGATGTCCTCCAGCACGCTTTCTGTTAGCAG
GCTCTCCTTAACGCCACTCTCAACCAGCTGCCGCTTGATCTCCGCGTGGA
TGGCGCTGCCTCCGTAGCTCTGATCCTTGAAGGCGGCCATGATTTGCACC
CCGCTGAAGACGGGCATAACGCTGGTCTCGCTGTAGCCAACGTCCACCAC
AAGGGCAGTGGGCACTGCCAGCGTAGACAGCGCAATGAGATGCACGGGCA
CGAACAGCACGGAGGAGACGTCGAAGTGGACAAAGAGCACGCGGGCCAAG
GTTTCACGCAGCACAGTGGATCCGAACACGTTCTCCACCAGCACGAACTT
GCGCTCCTTGGGGCTGACC

BO08945.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:32:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG12235-PA 1137 Arp11-RA 234..1134 919..19 4505 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
Arp10-RB 1536 CG12235-RB 494..1394 919..19 4505 100 Minus
Arp10-RA 1374 CG12235-RA 332..1232 919..19 4505 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 23:10:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19644673..19645573 19..919 4505 100 Plus
Blast to na_te.dros performed on 2015-02-10 23:10:12 has no hits.

BO08945.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:57:33 Download gff for BO08945.3prime
Subject Subject Range Query Range Percent Splice Strand
Arp11-PA 234..1137 18..919 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:56:16 Download gff for BO08945.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12235-PA 234..1137 18..919 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 08:03:03 Download gff for BO08945.3prime
Subject Subject Range Query Range Percent Splice Strand
Arp10-RA 332..1232 19..919 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 00:29:47 Download gff for BO08945.3prime
Subject Subject Range Query Range Percent Splice Strand
Arp10-RA 332..1232 19..919 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 00:29:47 Download gff for BO08945.3prime
Subject Subject Range Query Range Percent Splice Strand
X 19644673..19645573 19..919 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 08:03:03 Download gff for BO08945.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 19538706..19539606 19..919 100   Plus

BO08945.5prime Sequence

902 bp (878 high quality bases) assembled on 2006-01-10

> BO08945.5prime
GAAGTTATCAGTCGACATGCCCATTTACGAGAGCGTGATGCAGGAGAAGC
CGCCCATTGTCCTCGACATTGGCACCGCCTACACCAAGCTGGGATTCGCA
GCGGAGGCGTATCCGCGCAAGATCATGCCCACGGAGGTGGTGATGACCAC
GACGGGGATCCGGAAGCGTCTGTTCGACTACGACACTCCGGAGGAGCTGT
ACGACCAGCTAGTGGATTTTCTGCAGACGATCTTCTTCAAGCATCTACTG
GTCAGCCCCAAGGAGCGCAAGTTCGTGCTGGTGGAGAACGTGTTCGGATC
CACTGTGCTGCGTGAAACCTTGGCCCGCGTGCTCTTTGTCCACTTCGACG
TCTCCTCCGTGCTGTTCGTGCCCGTGCATCTCATTGCGCTGTCTACGCTG
GCAGTGCCCACTGCCCTTGTGGTGGACGTTGGCTACAGCGAGACCAGCGT
TATGCCCGTCTTCAGCGGGGTGCAAATCATGGCCGCCTTCAAGGATCAGA
GCTACGGAGGCAGCGCCATCCACGCGGAGATCAAGCGGCAGCTGGTTGAG
AGTGGCGTTAAGGAGAGCCTGCTAACAGAAAGCGTGCTGGAGGACATCAA
GGTGCGAACCTGCTTTGTGACCACCATGGAAAGAGCCAAGGCCCGCGCCA
ACGGCGACGAGAATCAGCCGACTCCCGCGCCAGACGTGGACTACATTGTC
AGCGACAACGATGCGGTCATCCAGGTGCCCGGCCTCCTGCGGGAGTCTGC
CTACGAGATCATGTTCGAGGCCAGCAACGAGCGGGACAGCCTGCCGCATC
TCATCCTGCGCTCCATTCTCGACTGCACACTAGACGTGCGACGTGCCCTG
GTCGAGAGTGTGTTCCTCGTGGGCGGCGGCTCAATGGTCCAGGGTCTGCT
GG

BO08945.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG12235-PA 1137 Arp11-RA 1..886 17..902 4430 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 01:26:12
Subject Length Description Subject Range Query Range Score Percent Strand
Arp10-RB 1536 CG12235-RB 261..1146 17..902 4430 100 Plus
Arp10-RA 1374 CG12235-RA 99..984 17..902 4430 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 01:26:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19644921..19645582 902..241 3310 100 Minus
X 23542271 X 19645632..19645785 241..88 770 100 Minus
X 23542271 X 19645845..19645916 88..17 360 100 Minus
Blast to na_te.dros performed on 2015-02-04 01:26:08 has no hits.

BO08945.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:57:34 Download gff for BO08945.5prime
Subject Subject Range Query Range Percent Splice Strand
Arp11-PA 1..886 17..902 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:56:18 Download gff for BO08945.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12235-PA 1..886 17..902 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 04:40:55 Download gff for BO08945.5prime
Subject Subject Range Query Range Percent Splice Strand
Arp10-RA 91..984 9..902 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 04:29:26 Download gff for BO08945.5prime
Subject Subject Range Query Range Percent Splice Strand
Arp10-RA 91..984 9..902 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 04:29:26 Download gff for BO08945.5prime
Subject Subject Range Query Range Percent Splice Strand
X 19645846..19645924 9..87 96   Minus
X 19645633..19645785 88..240 100 <- Minus
X 19644921..19645582 241..902 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 04:40:55 Download gff for BO08945.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 19539879..19539957 9..87 96   Minus
arm_X 19539666..19539818 88..240 100 <- Minus
arm_X 19538954..19539615 241..902 100 <- Minus

BO08945.complete Sequence

1168 bp (1168 high quality bases) assembled on 2006-01-18

GenBank Submission: FJ631328

> BO08945.complete
GAAGTTATCAGTCGACATGCCCATTTACGAGAGCGTGATGCAGGAGAAGC
CGCCCATTGTCCTCGACATTGGCACCGCCTACACCAAGCTGGGATTCGCA
GCGGAGGCGTATCCGCGCAAGATCATGCCCACGGAGGTGGTGATGACCAC
GACGGGGATCCGGAAGCGTCTGTTCGACTACGACACTCCGGAGGAGCTGT
ACGACCAGCTAGTGGATTTTCTGCAGACGATCTTCTTCAAGCATCTACTG
GTCAGCCCCAAGGAGCGCAAGTTCGTGCTGGTGGAGAACGTGTTCGGATC
CACTGTGCTGCGTGAAACCTTGGCCCGCGTGCTCTTTGTCCACTTCGACG
TCTCCTCCGTGCTGTTCGTGCCCGTGCATCTCATTGCGCTGTCTACGCTG
GCAGTGCCCACTGCCCTTGTGGTGGACGTTGGCTACAGCGAGACCAGCGT
TATGCCCGTCTTCAGCGGGGTGCAAATCATGGCCGCCTTCAAGGATCAGA
GCTACGGAGGCAGCGCCATCCACGCGGAGATCAAGCGGCAGCTGGTTGAG
AGTGGCGTTAAGGAGAGCCTGCTAACAGAAAGCGTGCTGGAGGACATCAA
GGTGCGAACCTGCTTTGTGACCACCATGGAAAGAGCCAAGGCCCGCGCCA
ACGGCGACGAGAATCAGCCGACTCCCGCGCCAGACGTGGACTACATTGTC
AGCGACAACGATGCGGTCATCCAGGTGCCCGGCCTCCTGCGGGAGTCTGC
CTACGAGATCATGTTCGAGGCCAGCAACGAGCGGGACAGCCTGCCGCATC
TCATCCTGCGCTCCATTCTCGACTGCACACTAGACGTGCGACGTGCCCTG
GTCGAGAGTGTGTTCCTCGTGGGCGGCGGCTCAATGGTCCAGGGTCTGCT
GGCCCGCCTCCGCCAGGAGCTGCAGCATCTGCTCACCGAGGATCCGTTCT
ACGCCGAACGCTTCCATGGCGAGCTGCAGTTCAAGTTTTTCAATGCTGTC
GGCAAGCAAAACTTTACTGCCTGGCTGGGCGGCGCCTTGTGCGGCGCGAC
GGATCTCATCCAGACACGATCGCTGGTCAAGGAGACGTATCTAAAGAGCG
AGCACGTTCCCGACTGGAGCAACCTGTGCGATAATAGGCCGACAGGCTCG
GCAAGCTTTCTAGACCAT

BO08945.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:41:27
Subject Length Description Subject Range Query Range Score Percent Strand
Arp10-RB 1137 CG12235-PB 1..1134 17..1150 5670 100 Plus
Arp10-RA 1137 CG12235-PA 1..1134 17..1150 5670 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
Arp10-RB 1536 CG12235-RB 261..1394 17..1150 5670 100 Plus
Arp10-RA 1374 CG12235-RA 99..1232 17..1150 5670 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19644673..19645582 1150..241 4550 100 Minus
X 23542271 X 19645632..19645785 241..88 770 100 Minus
X 23542271 X 19645845..19645916 88..17 360 100 Minus
Blast to na_te.dros performed on 2014-11-27 23:41:25 has no hits.

BO08945.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:09:05 Download gff for BO08945.complete
Subject Subject Range Query Range Percent Splice Strand
Arp11-RA 1..1137 17..1151 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:29:07 Download gff for BO08945.complete
Subject Subject Range Query Range Percent Splice Strand
Arp11-RA 123..1264 9..1150 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:35:31 Download gff for BO08945.complete
Subject Subject Range Query Range Percent Splice Strand
Arp10-RA 99..1232 17..1152 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:09:05 Download gff for BO08945.complete
Subject Subject Range Query Range Percent Splice Strand
Arp11-RA 123..1264 9..1150 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:06:13 Download gff for BO08945.complete
Subject Subject Range Query Range Percent Splice Strand
Arp10-RA 99..1232 17..1152 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:06:13 Download gff for BO08945.complete
Subject Subject Range Query Range Percent Splice Strand
X 19645846..19645916 17..87 100   Minus
X 19645633..19645785 88..240 100 <- Minus
X 19644671..19645582 241..1152 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:35:31 Download gff for BO08945.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19539879..19539949 17..87 100   Minus
arm_X 19539666..19539818 88..240 100 <- Minus
arm_X 19538704..19539615 241..1152 99 <- Minus

BO08945.pep Sequence

Translation from 16 to 1168

> BO08945.pep
MPIYESVMQEKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEVVMTTTGIRK
RLFDYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRE
TLARVLFVHFDVSSVLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFS
GVQIMAAFKDQSYGGSAIHAEIKRQLVESGVKESLLTESVLEDIKVRTCF
VTTMERAKARANGDENQPTPAPDVDYIVSDNDAVIQVPGLLRESAYEIMF
EASNERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLLARLRQ
ELQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQT
RSLVKETYLKSEHVPDWSNLCDNRPTGSASFLDH

BO08945.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:44:01
Subject Length Description Subject Range Query Range Score Percent Strand
Arp10-PB 378 CG12235-PB 1..378 1..378 1921 100 Plus
Arp10-PA 378 CG12235-PA 1..378 1..378 1921 100 Plus
Act57B-PA 376 CG10067-PA 5..366 10..361 212 21.9 Plus
Act87E-PC 376 CG18290-PC 5..366 10..361 210 21.6 Plus
Act87E-PB 376 CG18290-PB 5..366 10..361 210 21.6 Plus