Clone BO08958 Report

Search the DGRC for BO08958

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:89
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptYkt6-RA
Protein status:BO08958.pep: validated full length
Sequenced Size:631

Clone Sequence Records

BO08958.3prime Sequence

629 bp (628 high quality bases) assembled on 2006-01-10

> BO08958.3prime
ATGGTCTAGAAAGCTTGCGGTGAAGCTGCAGCAGGAGTTAGTCTTTTTCG
CCGTCTTGTAGAACGCCTTGCTCTGCAGCGACAATTTCTCCGACTTGCTG
ACCATGTCGTCCAGCTTCTCGCCCCGCTCCAGCACCGCCTCGATGGTATT
CTTCAGTATGATCTTCGTTTCGTCCAGGTCGTTTTGCATTTTCGTCAGCG
GATCTGCTTCGACGGGATTTTGATAGCGTGCTAGAAACGCTGGCAGCAAG
TCAAATGAGATAGTGGCCTCCGTGCCATTGGGCCACTGATCGGCCGACAC
CTTGGCCGTAAAGTCATCCAGAATCTTTGTGATAAGCGTGTGCGCCACGC
GATGCGGATACTCATGATCGGCGATCAGTACACCGGCCAGATTGTCCGCC
CGCACATAGACATGACACATGTAGGCATCCTGTTTCACCGATTGCCGCAG
GGCCGGCTGTGTGCGCTCCACAATCGTCTTCGAAGCGAAAGTCATGAACT
CGTTGACGGTGCCACGTTGGAAAAAGGAGAAGGACTGCAGGTCCGAGGCG
GTCTTCAGGAGACGCGCCTCGCTGGCGCCCTTGTGAAAGATGCTCAACGC
GAATAGTTTGACCATGTCGACTGATAACT

BO08958.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG1515-PA 600 l(1)G0155-RA 1..597 615..19 2985 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
Ykt6-RA 1469 CG1515-RA 268..864 615..19 2985 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7920890..7921361 490..19 2360 100 Minus
X 23542271 X 7920676..7920800 615..491 625 100 Minus
Blast to na_te.dros performed on 2015-02-11 04:51:54 has no hits.

BO08958.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:57:52 Download gff for BO08958.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1515-PA 1..600 18..615 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:56:43 Download gff for BO08958.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1515-PA 1..600 18..615 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 23:29:43 Download gff for BO08958.3prime
Subject Subject Range Query Range Percent Splice Strand
Ykt6-RA 260..864 19..623 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:30:00 Download gff for BO08958.3prime
Subject Subject Range Query Range Percent Splice Strand
Ykt6-RA 260..864 19..623 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:30:00 Download gff for BO08958.3prime
Subject Subject Range Query Range Percent Splice Strand
X 7920890..7921361 19..490 100   Minus
X 7920668..7920800 491..623 97 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 23:29:43 Download gff for BO08958.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 7814923..7815394 19..490 100   Minus
arm_X 7814701..7814833 491..623 97 -> Minus

BO08958.5prime Sequence

629 bp (628 high quality bases) assembled on 2006-01-10

> BO08958.5prime
GAAGTTATCAGTCGACATGGTCAAACTATTCGCGTTGAGCATCTTTCACA
AGGGCGCCAGCGAGGCGCGTCTCCTGAAGACCGCCTCGGACCTGCAGTCC
TTCTCCTTTTTCCAACGTGGCACCGTCAACGAGTTCATGACTTTCGCTTC
GAAGACGATTGTGGAGCGCACACAGCCGGCCCTGCGGCAATCGGTGAAAC
AGGATGCCTACATGTGTCATGTCTATGTGCGGGCGGACAATCTGGCCGGT
GTACTGATCGCCGATCATGAGTATCCGCATCGCGTGGCGCACACGCTTAT
CACAAAGATTCTGGATGACTTTACGGCCAAGGTGTCGGCCGATCAGTGGC
CCAATGGCACGGAGGCCACTATCTCATTTGACTTGCTGCCAGCGTTTCTA
GCACGCTATCAAAATCCCGTCGAAGCAGATCCGCTGACGAAAATGCAAAA
CGACCTGGACGAAACGAAGATCATACTGAAGAATACCATCGAGGCGGTGC
TGGAGCGGGGCGAGAAGCTGGACGACATGGTCAGCAAGTCGGAGAAATTG
TCGCTGCAGAGCAAGGCGTTCTACAAGACGGCGAAAAAGACTAACTCCTG
CTGCAGCTTCACCGCAAGCTTTCTAGACC

BO08958.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG1515-PA 600 l(1)G0155-RA 1..597 17..613 2985 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 07:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
Ykt6-RA 1469 CG1515-RA 268..864 17..613 2985 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 07:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7920890..7921361 142..613 2360 100 Plus
X 23542271 X 7920676..7920800 17..141 625 100 Plus
Blast to na_te.dros performed on 2015-02-13 07:54:01 has no hits.

BO08958.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:57:53 Download gff for BO08958.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1515-PA 1..600 17..614 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:56:44 Download gff for BO08958.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1515-PA 1..600 17..614 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 09:51:15 Download gff for BO08958.5prime
Subject Subject Range Query Range Percent Splice Strand
Ykt6-RA 260..864 9..613 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:58:50 Download gff for BO08958.5prime
Subject Subject Range Query Range Percent Splice Strand
Ykt6-RA 260..864 9..613 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 09:58:50 Download gff for BO08958.5prime
Subject Subject Range Query Range Percent Splice Strand
X 7920890..7921361 142..613 100   Plus
X 7920668..7920800 9..141 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 09:51:15 Download gff for BO08958.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 7814923..7815394 142..613 100   Plus
arm_X 7814701..7814833 9..141 97 -> Plus

BO08958.complete Sequence

631 bp (631 high quality bases) assembled on 2006-01-18

GenBank Submission: FJ631333

> BO08958.complete
GAAGTTATCAGTCGACATGGTCAAACTATTCGCGTTGAGCATCTTTCACA
AGGGCGCCAGCGAGGCGCGTCTCCTGAAGACCGCCTCGGACCTGCAGTCC
TTCTCCTTTTTCCAACGTGGCACCGTCAACGAGTTCATGACTTTCGCTTC
GAAGACGATTGTGGAGCGCACACAGCCGGCCCTGCGGCAATCGGTGAAAC
AGGATGCCTACATGTGTCATGTCTATGTGCGGGCGGACAATCTGGCCGGT
GTACTGATCGCCGATCATGAGTATCCGCATCGCGTGGCGCACACGCTTAT
CACAAAGATTCTGGATGACTTTACGGCCAAGGTGTCGGCCGATCAGTGGC
CCAATGGCACGGAGGCCACTATCTCATTTGACTTGCTGCCAGCGTTTCTA
GCACGCTATCAAAATCCCGTCGAAGCAGATCCGCTGACGAAAATGCAAAA
CGACCTGGACGAAACGAAGATCATACTGAAGAATACCATCGAGGCGGTGC
TGGAGCGGGGCGAGAAGCTGGACGACATGGTCAGCAAGTCGGAGAAATTG
TCGCTGCAGAGCAAGGCGTTCTACAAGACGGCGAAAAAGACTAACTCCTG
CTGCAGCTTCACCGCAAGCTTTCTAGACCAT

BO08958.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:35:20
Subject Length Description Subject Range Query Range Score Percent Strand
Ykt6-RA 600 CG1515-PA 1..597 17..613 2985 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:35:21
Subject Length Description Subject Range Query Range Score Percent Strand
Ykt6-RA 1469 CG1515-RA 268..864 17..613 2985 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:35:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7920890..7921361 142..613 2360 100 Plus
X 23542271 X 7920676..7920800 17..141 625 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:35:18 has no hits.

BO08958.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:09:18 Download gff for BO08958.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0155-RA 1..600 17..614 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:29:25 Download gff for BO08958.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0155-RA 208..812 9..613 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:18:29 Download gff for BO08958.complete
Subject Subject Range Query Range Percent Splice Strand
Ykt6-RA 268..864 17..615 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:09:18 Download gff for BO08958.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0155-RA 208..812 9..613 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:13:27 Download gff for BO08958.complete
Subject Subject Range Query Range Percent Splice Strand
Ykt6-RA 268..864 17..615 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:13:27 Download gff for BO08958.complete
Subject Subject Range Query Range Percent Splice Strand
X 7920890..7921361 142..615 99   Plus
X 7920676..7920800 17..141 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:18:29 Download gff for BO08958.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7814923..7815394 142..615 99   Plus
arm_X 7814709..7814833 17..141 100 -> Plus

BO08958.pep Sequence

Translation from 16 to 631

> BO08958.pep
MVKLFALSIFHKGASEARLLKTASDLQSFSFFQRGTVNEFMTFASKTIVE
RTQPALRQSVKQDAYMCHVYVRADNLAGVLIADHEYPHRVAHTLITKILD
DFTAKVSADQWPNGTEATISFDLLPAFLARYQNPVEADPLTKMQNDLDET
KIILKNTIEAVLERGEKLDDMVSKSEKLSLQSKAFYKTAKKTNSCCSFTA
SFLDH

BO08958.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
Ykt6-PA 199 CG1515-PA 1..199 1..199 1011 100 Plus