Clone BO09010 Report

Search the DGRC for BO09010

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:90
Well:10
Vector:pDNR-Dual
Associated Gene/Transcriptshtd-RB
Protein status:BO09010.pep: validated full length
Sequenced Size:1507

Clone Sequence Records

BO09010.3prime Sequence

762 bp (760 high quality bases) assembled on 2006-01-10

> BO09010.3prime
ATGGTCTAGAAAGCTTGCCTGGTCACCCATGGTGTACGCCAGAAGGGCTG
CCTCATCCAGAGTCACCACTTCGGTGGCCAGTGACTGTAGGATCTTCATT
AGGCCAAATATGGTGTGCGCGCCGAGATTCAGCCGGCGGAATTCGTATAA
AAGACGCATATAGTTAACTGTGCCCGTGCTCAAGTCCACTCCATTCAACA
TATTCGGCAACAGATTGTAGTAATTGATCACGCAGAAGGCTCGCTGCAAG
TCCGGTCCACTGACTGTGGTCACATAGCTGGGATCCAGACGCCTTCGGCT
GAGGAACTCGCGCAGCGGTAAGCACAACTCGCGCGTCGAGTCCTCCATTT
CCTGCTTGAAGAGCTCTTGCATCATTTGGATAAGCTCCACGGAGATGAGC
GGATGCTCGGACTCCTGGCTGCGACTCAAATAGGCATCGATGAGCTTCAT
CTGCCACACATCGATGTTGTTCGGCATGGACTTGGTTACGTGATCGTATA
GGGTTAGGTAAACCGGCAGGAAATGCATGCGATCCTTGACCACGGCATTG
TAGAATAGCAGCATCACCTGGTGCCGCTTCATCAGCTCCGGGGGACTCAA
ATCCGTGCCTTTGGTGTCCAGGCAGCGACTGAGGAACTGCTTCACCATAC
GTTCGCTGGCAAACTGCTGCAGGTCGTTCATATCGATCTGCCAACAGATG
CTCTGTTCCATCGTCAATGTTTGGGCCAGCATGCTCTTCAGCCTGTCCGG
GTCCTCCAAGTG

BO09010.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG9198-PA 6093 shtd-RA 5347..6090 762..19 3720 100 Minus
CG9198-PB 1476 shtd-RB 730..1473 762..19 3720 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-03 09:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
shtd-RA 6481 CG9198-RA 5453..6196 762..19 3720 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-03 09:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15455829..15456302 19..492 2370 100 Plus
X 23542271 X 15456362..15456631 493..762 1350 100 Plus
Blast to na_te.dros performed on 2015-02-03 09:09:59 has no hits.

BO09010.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:59:07 Download gff for BO09010.3prime
Subject Subject Range Query Range Percent Splice Strand
shtd-PB 730..1476 16..762 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:58:33 Download gff for BO09010.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9198-PB 730..1476 16..762 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 04:44:36 Download gff for BO09010.3prime
Subject Subject Range Query Range Percent Splice Strand
shtd-RA 5453..6196 19..762 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-03 09:58:48 Download gff for BO09010.3prime
Subject Subject Range Query Range Percent Splice Strand
shtd-RA 5453..6196 19..762 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-03 09:58:48 Download gff for BO09010.3prime
Subject Subject Range Query Range Percent Splice Strand
X 15456362..15456631 493..762 100   Plus
X 15455830..15456302 20..492 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 04:44:36 Download gff for BO09010.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 15350395..15350664 493..762 100   Plus
arm_X 15349863..15350335 20..492 100 <- Plus

BO09010.5prime Sequence

925 bp (749 high quality bases) assembled on 2006-01-10

> BO09010.5prime
GAAGTTATCAGTCGACATGGCTGGAGCTGCCTTCTGCATTGGTCTCAAGT
ACGCCGGCACTGAGAATCTGGTGGCCTTTGCCACGCTGCGGTCGGTGATA
AAGGATTTCCTTCGCTTCCCCAGCAGGCCGATGGGCGAATGTGCCGGTCG
CACCACTGTGGAGAGCTGCCTGATGGTGCTGCTCATCTCGATCTCGTTGG
TGTTCGCCGGCTCCGGCAACTGCGAAATTCTTCGCATAATTCGGTTTCTC
AGGTCGCGAGTGGGACCACAATATCCGCACATAACCTACGGCTCTCACAT
GGCCATACACATGTCGCTTGGCCTGCTATTCCTCGGCGCGGGTCGCTTCA
CCATTTCCCAGACACCGGAGTCGATTGCTGCACTGGTCTGCGCCTTCTTC
CCCAAGTTTCCCATACACAGCAACGACAATCGATACCATCTGCAAGCGCT
GAGACATCTCTATGTACTGGCTGTGGAACCGCGCCTGTTCCTTCCCCGGG
ACATTGACACCAATAAGCTGTGCCTGGCCAACATATCCGTGTTGGAGGTG
GGTGCCACCGAGCTGCGCCGCCTGCCCATCGCTCCCTGCATCCTGCCAGT
GCTGAGCACCCTGCAGCAGGTGGTGGTGGACGACGAGAACTATTGGCCAG
TGTGCTTCGAGCGATCGCGCAACTGGGATCAGCTGGAAAAGGCGCTGGAG
ATGAGTGCACCGATTGATATTAAGAAGCGAACGGGCTGCCTTTCCCACTT
GGAGGACCCGGACAGGCTGAAGAGCATGCTGGCCCAAACATTGACGATGG
AACAGAGCATCTGTTGGCAGATCGATATGAACGACCTGCAGCAGTTTGCC
AGCGAACGTATGGTGAAGCAGTTCCTCAGTCGCTGCCTGGACACCAAAGG
CACGGATTTGAGTCCCCCGGAGCTG

BO09010.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG9198-PA 6093 shtd-RA 4617..5526 16..925 4550 100 Plus
CG9198-PB 1476 shtd-RB 1..909 17..925 4545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:42:14
Subject Length Description Subject Range Query Range Score Percent Strand
shtd-RA 6481 CG9198-RA 4723..5632 16..925 4550 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15456452..15456945 925..432 2470 100 Minus
X 23542271 X 15457009..15457425 432..16 2085 100 Minus
Blast to na_te.dros performed on 2015-02-11 17:42:12 has no hits.

BO09010.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:59:08 Download gff for BO09010.5prime
Subject Subject Range Query Range Percent Splice Strand
shtd-PA 4611..5526 9..925 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:58:34 Download gff for BO09010.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9198-PA 4611..5526 9..925 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 14:20:18 Download gff for BO09010.5prime
Subject Subject Range Query Range Percent Splice Strand
shtd-RA 4717..5632 9..925 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:18:50 Download gff for BO09010.5prime
Subject Subject Range Query Range Percent Splice Strand
shtd-RA 4717..5632 9..925 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:18:50 Download gff for BO09010.5prime
Subject Subject Range Query Range Percent Splice Strand
X 15457009..15457431 9..432 99   Minus
X 15456452..15456944 433..925 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 14:20:18 Download gff for BO09010.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 15351042..15351464 9..432 99   Minus
arm_X 15350485..15350977 433..925 100 <- Minus

BO09010.complete Sequence

1507 bp (1507 high quality bases) assembled on 2006-01-25

GenBank Submission: FJ631350

> BO09010.complete
GAAGTTATCAGTCGACATGGCTGGAGCTGCCTTCTGCATTGGTCTCAAGT
ACGCCGGCACTGAGAATCTGGTGGCCTTTGCCACGCTGCGGTCGGTGATA
AAGGATTTCCTTCGCTTCCCCAGCAGGCCGATGGGCGAATGTGCCGGTCG
CACCACTGTGGAGAGCTGCCTGATGGTGCTGCTCATCTCGATCTCGTTGG
TGTTCGCCGGCTCCGGCAACTGCGAAATTCTTCGCATAATTCGGTTTCTC
AGGTCGCGAGTGGGACCACAATATCCGCACATAACCTACGGCTCTCACAT
GGCCATACACATGTCGCTTGGCCTGCTATTCCTCGGCGCGGGTCGCTTCA
CCATTTCCCAGACACCGGAGTCGATTGCTGCACTGGTCTGCGCCTTCTTC
CCCAAGTTTCCCATACACAGCAACGACAATCGATACCATCTGCAAGCGCT
GAGACATCTCTATGTACTGGCTGTGGAACCGCGCCTGTTCCTTCCCCGGG
ACATTGACACCAATAAGCTGTGCCTGGCCAACATATCCGTGTTGGAGGTG
GGTGCCACCGAGCTGCGCCGCCTGCCCATCGCTCCCTGCATCCTGCCAGT
GCTGAGCACCCTGCAGCAGGTGGTGGTGGACGACGAGAACTATTGGCCAG
TGTGCTTCGAGCGATCGCGCAACTGGGATCAGCTGGAAAAGGCGCTGGAG
ATGAGTGCACCGATTGATATTAAGAAGCGAACGGGCTGCCTTTCCCACTT
GGAGGACCCGGACAGGCTGAAGAGCATGCTGGCCCAAACATTGACGATGG
AACAGAGCATCTGTTGGCAGATCGATATGAACGACCTGCAGCAGTTTGCC
AGCGAACGTATGGTGAAGCAGTTCCTCAGTCGCTGCCTGGACACCAAAGG
CACGGATTTGAGTCCCCCGGAGCTGATGAAGCGGCACCAGGTGATGCTGC
TATTCTACAATGCCGTGGTCAAGGATCGCATGCATTTCCTGCCGGTTTAC
CTAACCCTATACGATCACGTAACCAAGTCCATGCCGAACAACATCGATGT
GTGGCAGATGAAGCTCATCGATGCCTATTTGAGTCGCAGCCAGGAGTCCG
AGCATCCGCTCATCTCCGTGGAGCTTATCCAAATGATGCAAGAGCTCTTC
AAGCAGGAAATGGAGGACTCGACGCGCGAGTTGTGCTTACCGCTGCGCGA
GTTCCTCAGCCGAAGGCGTCTGGATCCCAGCTATGTGACCACAGTCAGTG
GACCGGACTTGCAGCGAGCCTTCTGCGTGATCAATTACTACAATCTGTTG
CCGAATATGTTGAATGGAGTGGACTTGAGCACGGGCACAGTTAACTATAT
GCGTCTTTTATACGAATTCCGCCGGCTGAATCTCGGCGCGCACACCATAT
TTGGCCTAATGAAGATCCTACAGTCACTGGCCACCGAAGTGGTGACTCTG
GATGAGGCAGCCCTTCTGGCGTACACCATGGGTGACCAGGCAAGCTTTCT
AGACCAT

BO09010.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
shtd-RA 6093 CG9198-PA 4617..6090 16..1489 7370 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
shtd-RA 6481 CG9198-RA 4723..6196 16..1489 7370 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15456362..15456945 1015..432 2920 100 Minus
X 23542271 X 15455829..15456302 1489..1016 2370 100 Minus
X 23542271 X 15457009..15457425 432..16 2085 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:09:35 has no hits.

BO09010.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:09:00 Download gff for BO09010.complete
Subject Subject Range Query Range Percent Splice Strand
shtd-RA 4611..6093 9..1492 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:29:00 Download gff for BO09010.complete
Subject Subject Range Query Range Percent Splice Strand
shtd-RB 16..1495 9..1489 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:50:08 Download gff for BO09010.complete
Subject Subject Range Query Range Percent Splice Strand
shtd-RA 4724..6196 17..1491 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:09:00 Download gff for BO09010.complete
Subject Subject Range Query Range Percent Splice Strand
shtd-RB 16..1495 9..1489 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:12:09 Download gff for BO09010.complete
Subject Subject Range Query Range Percent Splice Strand
shtd-RA 4724..6196 17..1491 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:12:09 Download gff for BO09010.complete
Subject Subject Range Query Range Percent Splice Strand
X 15457009..15457424 17..432 100   Minus
X 15456362..15456944 433..1015 100 <- Minus
X 15455826..15456302 1016..1491 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:50:08 Download gff for BO09010.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15351042..15351457 17..432 100   Minus
arm_X 15350395..15350977 433..1015 100 <- Minus
arm_X 15349859..15350335 1016..1491 99 <- Minus

BO09010.pep Sequence

Translation from 16 to 1507

> BO09010.pep
MAGAAFCIGLKYAGTENLVAFATLRSVIKDFLRFPSRPMGECAGRTTVES
CLMVLLISISLVFAGSGNCEILRIIRFLRSRVGPQYPHITYGSHMAIHMS
LGLLFLGAGRFTISQTPESIAALVCAFFPKFPIHSNDNRYHLQALRHLYV
LAVEPRLFLPRDIDTNKLCLANISVLEVGATELRRLPIAPCILPVLSTLQ
QVVVDDENYWPVCFERSRNWDQLEKALEMSAPIDIKKRTGCLSHLEDPDR
LKSMLAQTLTMEQSICWQIDMNDLQQFASERMVKQFLSRCLDTKGTDLSP
PELMKRHQVMLLFYNAVVKDRMHFLPVYLTLYDHVTKSMPNNIDVWQMKL
IDAYLSRSQESEHPLISVELIQMMQELFKQEMEDSTRELCLPLREFLSRR
RLDPSYVTTVSGPDLQRAFCVINYYNLLPNMLNGVDLSTGTVNYMRLLYE
FRRLNLGAHTIFGLMKILQSLATEVVTLDEAALLAYTMGDQASFLDH

BO09010.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
shtd-PA 2030 CG9198-PA 1540..2030 1..491 2540 100 Plus