Clone BO09107 Report

Search the DGRC for BO09107

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:91
Well:7
Vector:pDNR-Dual
Associated Gene/TranscriptSyx18-RA
Protein status:BO09107.pep: validated full length
Sequenced Size:1219

Clone Sequence Records

BO09107.3prime Sequence

917 bp (808 high quality bases) assembled on 2006-01-11

> BO09107.3prime
ATGGTCTAGAAAGCTTGCATCGTAGTACCAGTCCAAGAAGAGCAGGGAGA
ACGACATGACCAGCAGGAAGAACAGCGACCACACGCGTAGTCCTGCATTT
CGTTGAGTGGCCTGCCGGATTTGCTCGTTGGCGTCCTTGACGTTTTCCGT
GGTGCCCACGACGGCACTAACTATCCTGTCGATATTGTGCTGTTGCATGG
CGACCTTTTCGGTGAAAATGTCCTGCAGTTGGGCAATGTCTACCACGTTC
TTTTCGATCTGCTCCACCTCCTCGGAGACGCCCTGCAGAAAGTTGTAGAT
GTGTACGTTCTCCGCCTCGAAGAGCTGCACATCCTCGGCGCTTAGGGGAT
CGTCATCGTCGGCCTCCTGCTGCTGCTGGAGCTCCTCATCCAGAGCCATC
TTGGAGGATGAGTTGTTCAGATCCGATCTGTTGGCTTTGCTTCGTTTGCG
CGTACGCGGTTTGTGTTGATTGGCCTGATTGGCTTCCTTGCCCTTCTCGC
CATCGTGATCGTCCACCTCGTCGCCTTCCTCGTCTTCATCCCAGTCGCCC
CAGGCGTCGTTATTCCAGTCATTGTCGGCGGACTCGTCGTGGTTGCCATT
TGCTTGTGAAGATGACTTCGTGGCTTCGCTGTCATCGTTGCTGACCTGGC
GCCTGCCCAGCTTGCCACTGTTGCTGCCCGCCGGACGCACTGGTATCTTC
TTTTTGTCCGCCGCCAGCTTGAGCAGCCTATAGGTTTCCAGTTCGTGTTG
CACACGGTACTTCTTTTGGTCCAGATAGATCTGTTCCACGCTGTGCAAAT
AGCTGACCAGCAGGTCCAGCACGGCGTCGATGTGCTGACGCTCCTGCGGC
TTCCGCTTGGCGCTCTTCCAATCGCTGCGCATCTTGGCCAGGTGCTGCGT
GTAAAAAGTGACGAACT

BO09107.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:35:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG13626-PA 1188 Syx18-RA 287..1185 917..19 4470 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:58:17
Subject Length Description Subject Range Query Range Score Percent Strand
Syx18-RA 1442 CG13626-RA 376..1274 917..19 4480 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 22:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24624473..24625187 203..917 3560 99.9 Plus
3R 32079331 3R 24623970..24624157 19..206 940 100 Plus
Blast to na_te.dros performed on 2015-02-10 22:58:14 has no hits.

BO09107.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 04:02:02 Download gff for BO09107.3prime
Subject Subject Range Query Range Percent Splice Strand
Syx18-PA 287..1188 15..917 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 03:02:25 Download gff for BO09107.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13626-PA 287..1188 15..917 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 18:27:40 Download gff for BO09107.3prime
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 376..1278 14..917 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 00:15:47 Download gff for BO09107.3prime
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 376..1278 14..917 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 00:15:47 Download gff for BO09107.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 24624475..24625187 205..917 99   Plus
3R 24623966..24624155 14..204 98 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 18:27:40 Download gff for BO09107.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20450197..20450909 205..917 99   Plus
arm_3R 20449688..20449877 14..204 98 <- Plus

BO09107.5prime Sequence

815 bp (779 high quality bases) assembled on 2006-01-10

> BO09107.5prime
GAAGTTATCAGTCGACATGGACATCACCCAGAGCTTCAAGGCCAGCGTAA
TGACGGTGCGCCTGCAGCGCAAGGCCGAGCTGGCCGGAAAGGCCAAGCCC
GCCACAGTGCCGACAAAAACTGGACCAATTGGCCCAAAGGATGACTTCGC
CAAGCAGGCCAAGGAGGTGTGCAACAAGATCACTTCGCTGCGCAATGTGC
TGATCGAGAACCGCACCGCCTACATGCGCATTGGCCAGCACCTCAAGTCC
GCCGCACACATGACCGACGCGCAGCGGGATCTGATTGATCGCGAGTCGGA
GAAGTTCGTCACCTTTTACACGCAGCACCTGGCCAAGATGCGCAGCGATT
GGAAGAGCGCCAAGCGGAAGCCGCAGGAGCGTCAGCACATCGACGCCGTG
CTGGACCTGCTGGTCAGCTATTTGCACAGCGTGGAACAGATCTATCTGGA
CCAAAAGAAGTACCGTGTGCAACACGAACTGGAAACCTATAGGCTGCTCA
AGCTGGCGGCGGACAAAAAGAAGATACCAGTGCGTCCGGCGGGCAGCAAC
AGTGGCAAGCTGGGCAGGCGCCAGGTCAGCAACGATGACAGCGAAGCCAC
GAAGTCATCTTCACAAGCAAATGGCAACCACGACGAGTCCGCCGACAATG
ACTGGAATAACGACGCCTGGGGCGACTGGGATGAAGACGAGGAAGGCGAC
GAGGTGGACGATCACGATGGCGAGAAGGGCAAGGAAGCCAATCAGGCCAA
TCAACACAAACCGCGTACGCGCAAACGAAGCAAAGCCAACAGATCGGATC
TGAACAACTCATCCT

BO09107.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:35:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG13626-PA 1188 Syx18-RA 1..799 17..815 3995 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:46:50
Subject Length Description Subject Range Query Range Score Percent Strand
Syx18-RA 1442 CG13626-RA 90..888 17..815 3995 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24624675..24625473 815..17 3995 100 Minus
Blast to na_te.dros performed on 2015-02-12 11:46:47 has no hits.

BO09107.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 04:02:03 Download gff for BO09107.5prime
Subject Subject Range Query Range Percent Splice Strand
Syx18-PA 1..799 17..815 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 03:02:27 Download gff for BO09107.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13626-PA 1..799 17..815 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 05:28:00 Download gff for BO09107.5prime
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 90..888 17..815 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:43:07 Download gff for BO09107.5prime
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 90..888 17..815 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:43:07 Download gff for BO09107.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 24624675..24625473 17..815 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 05:28:00 Download gff for BO09107.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20450397..20451195 17..815 100   Minus

BO09107.complete Sequence

1219 bp (1219 high quality bases) assembled on 2006-01-25

GenBank Submission: FJ631394

> BO09107.complete
GAAGTTATCAGTCGACATGGACATCACCCAGAGCTTCAAGGCCAGCGTAA
TGACGGTGCGCCTGCAGCGCAAGGCCGAGCTGGCCGGAAAGGCCAAGCCC
GCCACAGTGCCGACAAAAACTGGACCAATTGGCCCAAAGGATGACTTCGC
CAAGCAGGCCAAGGAGGTGTGCAACAAGATCACTTCGCTGCGCAATGTGC
TGATCGAGAACCGCACCGCCTACATGCGCATTGGCCAGCACCTCAAGTCC
GCCGCACACATGACCGACGCGCAGCGGGATCTGATTGATCGCGAGTCGGA
GAAGTTCGTCACCTTTTACACGCAGCACCTGGCCAAGATGCGCAGCGATT
GGAAGAGCGCCAAGCGGAAGCCGCAGGAGCGTCAGCACATCGACGCCGTG
CTGGACCTGCTGGTCAGCTATTTGCACAGCGTGGAACAGATCTATCTGGA
CCAAAAGAAGTACCGTGTGCAACACGAACTGGAAACCTATAGGCTGCTCA
AGCTGGCGGCGGACAAAAAGAAGATACCAGTGCGTCCGGCGGGCAGCAAC
AGTGGCAAGCTGGGCAGGCGCCAGGTCAGCAACGATGACAGCGAAGCCAC
GAAGTCATCTTCACAAGCAAATGGCAACCACGACGAGTCCGCCGACAATG
ACTGGAATAACGACGCCTGGGGCGACTGGGATGAAGACGAGGAAGGCGAC
GAGGTGGACGATCACGATGGCGAGAAGGGCAAGGAAGCCAATCAGGCCAA
TCAACACAAACCGCGTACGCGCAAACGAAGCAAAGCCAACAGATCGGATC
TGAACAACTCATCCTCCAAGATGGCTCTGGATGAGGAGCTCCAGCAGCAG
CAGGAGGCCGACGATGACGATCCCCTAAGCGCCGAGGATGTGCAGCTCTT
CGAGGCGGAGAACGTACACATCTACAACTTTCTGCAGGGCGTCTCCGAGG
AGGTGGAGCAGATCGAAAAGAACGTGGTAGACATTGCCCAACTGCAGGAC
ATTTTCACCGAAAAGGTCGCCATGCAACAGCACAATATCGACAGGATAGT
TAGTGCCGTCGTGGGCACCACGGAAAACGTCAAGGACGCCAACGAGCAAA
TCCGGCAGGCCACTCAACGAAATGCAGGACTACGCGTGTGGTCGCTGTTC
TTCCTGCTGGTCATGTCGTTCTCCCTGCTCTTCTTGGACTGGTACTACGA
TGCAAGCTTTCTAGACCAT

BO09107.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:05:19
Subject Length Description Subject Range Query Range Score Percent Strand
Syx18-RA 1188 CG13626-PA 1..1185 17..1201 5925 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:05:20
Subject Length Description Subject Range Query Range Score Percent Strand
Syx18-RA 1442 CG13626-RA 90..1274 17..1201 5925 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:05:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24624473..24625473 1017..17 5005 100 Minus
3R 32079331 3R 24623970..24624157 1201..1014 940 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:05:18 has no hits.

BO09107.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:08:22 Download gff for BO09107.complete
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 1..1188 17..1205 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:28:07 Download gff for BO09107.complete
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 108..1296 17..1206 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:04:45 Download gff for BO09107.complete
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 90..1274 17..1203 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:08:22 Download gff for BO09107.complete
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 108..1296 17..1206 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:02:38 Download gff for BO09107.complete
Subject Subject Range Query Range Percent Splice Strand
Syx18-RA 90..1274 17..1203 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:02:38 Download gff for BO09107.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24624475..24625473 17..1015 100   Minus
3R 24623968..24624155 1016..1203 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:04:45 Download gff for BO09107.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20450197..20451195 17..1015 100   Minus
arm_3R 20449690..20449877 1016..1203 98 <- Minus

BO09107.pep Sequence

Translation from 16 to 1219

> BO09107.pep
MDITQSFKASVMTVRLQRKAELAGKAKPATVPTKTGPIGPKDDFAKQAKE
VCNKITSLRNVLIENRTAYMRIGQHLKSAAHMTDAQRDLIDRESEKFVTF
YTQHLAKMRSDWKSAKRKPQERQHIDAVLDLLVSYLHSVEQIYLDQKKYR
VQHELETYRLLKLAADKKKIPVRPAGSNSGKLGRRQVSNDDSEATKSSSQ
ANGNHDESADNDWNNDAWGDWDEDEEGDEVDDHDGEKGKEANQANQHKPR
TRKRSKANRSDLNNSSSKMALDEELQQQQEADDDDPLSAEDVQLFEAENV
HIYNFLQGVSEEVEQIEKNVVDIAQLQDIFTEKVAMQQHNIDRIVSAVVG
TTENVKDANEQIRQATQRNAGLRVWSLFFLLVMSFSLLFLDWYYDASFLD
H

BO09107.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
Syx18-PA 395 CG13626-PA 1..395 1..395 2034 100 Plus