Clone BO10690 Report

Search the DGRC for BO10690

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:106
Well:90
Vector:pDNR-Dual
Associated Gene/TranscriptPask-RA
Protein status:BO10690.pep: Imported from assembly
Sequenced Size:2989

Clone Sequence Records

BO10690.3prime Sequence

973 bp (884 high quality bases) assembled on 2006-04-19

> BO10690.3prime
ATGGTCTAGAAAGCTTGCTTTCAGATCAAGCTTCTTGGGTTTCGTGCTCA
CGTCGTGCAGACTAACTACGTTATAAGTGGAGACGCAGGGCTGAAGCTTG
TTCTTGAATATATCGTTCTCGGATTTCGAGGAGCATATTGAACCGCCGAT
TTCTGTGTGGCTTGAGTCAGGTAACGAGACCCTCAGCTCGTGGTTACTCA
CTGAGGTGTTTAGCTGGAACTGTTTCGCGTAAAGAGTGTCCATTTTGTTG
TGCTTGGCTTCATTAACGCACAACTTGTGTCCGGTTCTGTGGGATGCTAA
TCTGGCGTCATCGCTGCCCCCAATCGAGGACTCCTCGATGTGGGAGAAGC
TCTCCTGCGGTGAAATAGTGGACAGCACCGAAGTACTGGAGTATAGGTAG
CCGGAAAAATACAGATTCGGATTGGCCTCGTGGGCCTTGCACGGCACTAT
CCACGAGAAACTGAAAGTAGAGGGATTCACCTCCTGGGTGAGCCATGGAT
CTGTGATTAACTGGTGCATGGTGCACCGGTACTTGGGATCCTTATTCAGC
ATGGAGCTCAACAGACGGCTCAATTGCTCGGACACAGCTTTCGGTATTTG
AATCTCGGCCTTCAATGTCTCCTCCACATCGATGAATGGATTTTCGAAAA
ACATCAGAACGTAAAGCGTCACACCAAGGGCCCAAATCTCCAGCTCGGGA
CCCACGTATCTGTTTCCGGCCAGAACCTCCGGACTGCAGTACTCCGTCGT
GCCGTAGAACGTGGAGAAGAATTTTCCCTCCTCCATGAAGGTCGCCGATC
CGAAGTCAATCAGCTTTATGGTGAAGTTCTGGTCAATATAATGTTCTCGT
CCTTGATGTCCCGATGCAGTATCTTCTGTTCGTGCAGATAGTTGACGGCA
TCGGCCACCTGACGAAAAATGTAGCTTCCCAGCTTTTCGTCCATCAGGGG
CGCCGCTCTATGAACGTCCATAG

BO10690.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:08:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG3105-PA 2958 CG3105-RA 2137..2955 837..19 4095 100 Minus
CG3105-PA 2958 CG3105-RA 2022..2136 951..837 575 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 04:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
Pask-RA 3184 CG3105-RA 2092..3048 973..19 4735 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 04:25:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23990897..23991614 973..258 3490 99.7 Minus
2R 25286936 2R 23991673..23991913 259..19 1205 100 Minus
Blast to na_te.dros performed on 2015-02-12 04:25:31 has no hits.

BO10690.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 04:46:27 Download gff for BO10690.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3105-PA 1999..2958 16..973 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:02:28 Download gff for BO10690.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3105-PA 1999..2958 16..973 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 23:25:54 Download gff for BO10690.3prime
Subject Subject Range Query Range Percent Splice Strand
Pask-RA 2092..3055 11..973 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:01:28 Download gff for BO10690.3prime
Subject Subject Range Query Range Percent Splice Strand
Pask-RA 2092..3055 11..973 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:01:28 Download gff for BO10690.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 23991675..23991920 11..257 98   Minus
2R 23990897..23991614 258..973 99 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 23:25:54 Download gff for BO10690.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19879198..19879443 11..257 98   Minus
arm_2R 19878420..19879137 258..973 99 -> Minus

BO10690.5prime Sequence

968 bp (757 high quality bases) assembled on 2006-04-19

> BO10690.5prime
GAAGTTATCAGTCGACATGGAGGATCAGGGCGACGTGACAGACCAAGCCG
CTGGTAAGCTGAGTAGTTCGAATGCCCAGTGCTCCAGAAACCGATGTGCT
AATGATGACCCCATTATGGGCAGCCACAGTCAGAGTCGCCAGAACTCGTC
CGGCATGCTGAACATGATGGACGCCAGCTCCTTCAGCATGCCCCCCCCCA
ATCTGCACTCCTCAAAGGTGATCAACCCGAACAAGGCGATATTCACAATC
GACGCGAACACAGGGCAAATTTTTATAGTGAACAACAAGGCCTGCCAGCT
GCTGGGCTACACGTCGCAGGAGTTGAGGAACAAGGGATTCTTCGACCTGC
TTAACGGCAAGACAGAGAGCCACATCTCCTCCCTGGCGGAGATGCAGATC
GAAGGCGATGAGGGCCGGGTCGTCCTGCTAAGTGGAAAGGTCATCGAGAT
GAAGACCAAGTCGGGCGGCAAGATCCTGGTCTCTCTCTGGATCCGGCAGA
TCAGCAGCGATGGCCGACACATAGCCGTCGCGGAGCCTGTGGAGAGGCAT
ATTTGCCACATCAGCACCGATAGATCCGGAGTGATAACATCCGTTGACTC
CACCACGGCCACCATATTCTTTTATGAATCCGTCGAAAGCGTGGTGGGTG
TCAGCATTGTCACCCTTATCCCGTTTATAAAGCTGCCCGATCCGGATAGC
CGTGAGATCCCCAAGAGCCTGCGGAAGCAGAGAGCTACTGGTCGAACTAC
GGATAACGTAAAGTTTCCCCTGTGCTTGCTAATAGCCCTGGACGAGGATG
CTTCTGCGGGGTATTCCCATTCGGGGAAAACCGGTCTAAATATCACCGTC
TGGGTGTTCCAGAATCTTAGTGGGCTGATTGTGGTAGATGACATAGGCAA
CATACTGATGTGCACCAGCCTTTCTCGCTGCTAATGTTCGGATATGGTCA
GGACAAGATAATGACATG

BO10690.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:08:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG3105-PA 2958 CG3105-RA 1..898 17..914 4440 99.7 Plus
CG3105-PA 2958 CG3105-RA 899..949 914..964 255 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
Pask-RA 3184 CG3105-RA 94..1042 17..964 4690 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23988986..23989847 104..964 4230 99.7 Plus
2R 25286936 2R 23988831..23988918 17..104 440 100 Plus
Blast to na_te.dros performed on 2015-02-12 11:23:28 has no hits.

BO10690.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 04:46:28 Download gff for BO10690.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3105-PA 1..954 17..968 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:02:30 Download gff for BO10690.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3105-PA 1..954 17..968 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 06:14:46 Download gff for BO10690.5prime
Subject Subject Range Query Range Percent Splice Strand
Pask-RA 94..1047 17..968 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:37:15 Download gff for BO10690.5prime
Subject Subject Range Query Range Percent Splice Strand
Pask-RA 94..1047 17..968 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:37:15 Download gff for BO10690.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 23988987..23989852 105..968 99   Plus
2R 23988831..23988918 17..104 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 06:14:46 Download gff for BO10690.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19876510..19877375 105..968 99   Plus
arm_2R 19876354..19876441 17..104 100 -> Plus

BO10690.complete Sequence

2989 bp assembled on 2010-09-13

GenBank Submission: KX798930

> BO10690.complete
GAAGTTATCAGTCGACATGGAGGATCAGGGCGACGTGACAGACCAAGCCG
CTGGTAAGCTGAGTAGTTCGAATGCCCAGTGCTCCAGAAACCGATGTGCT
AATGATGACCCCATTATGGGCAGCCACAGTCAGAGTCGCCAGAACTCGTC
CGGCATGCTGAACATGATGGACGCCAGCTCCTTCAGCATGCCCCCCCCCA
ATCTGCACTCCTCAAAGGTGATCAACCCGAACAAGGCGATATTCACAATC
GACGCGAACACAGGGCAAATTTTTATAGTGAACAACAAGGCCTGCCAGCT
GCTGGGCTACACGTCGCAGGAGTTGAGGAACAAGGGATTCTTCGACCTGC
TTAACGGCAAGACAGAGAGCCACATCTCCTCCCTGGCGGAGATGCAGATC
GAAGGCGATGAGGGCCGGGTCGTCCTGCTAAGTGGAAAGGTCATCGAGAT
GAAGACCAAGTCGGGCGGCAAGATCCTGGTCTCTCTCTGGATCCGGCAGA
TCAGCAGCGATGGCCGACACATAGCCGTCGCGGAGCCTGTGGAGAGGCAT
ATTTGCCACATCAGCACCGATAGATCCGGAGTGATAACATCCGTTGACTC
CACCACGGCCACCATATTCTTTTATGAATCCGTCGAAAGCGTGGTGGGTG
TCAGCATTGTCACCCTTATCCCGTTTATAAAGCTGCCCGATCCGGATAGC
CGTGAGATCCCCAAGAGCCTGCGGAAGCAGAGAGCTACTGGTCGAACTAC
GGATAACGTAAAGTTTCCCCTGTGCTTGCTAATAGCCCTGGACGAGGATG
CTTCTGCGGGGTATTCCCATTCGGGAAAAACCGGTCTAAATATCACCGTC
TGGGTGTTCCAGAATCTTAGTGGCCTGATTGTGGTAGATGACATAGGCAA
CATACTGATGTGCAACCAGCCTTTCTCGCTGCTAATGTTCGGATATGGTC
AGGACAAGATAATGAACATGCATATATCGGCGATCCTACCCAATTTCGGC
AAGGACTCTCGCGAGGAGAAGAGTCCGAATGTTTCGAACACCTCGATAAC
CAGTAACGACTGGGAGCCGGACACGGATCCCCTCGTCGTGGACAACGACT
CCTCGCTGCAATCCTGCAAGAAGAGCTCGACTAACAGGACGGCGCCCAAC
AACGAACAGTCTTCGGTGGGCGATGCCCACCTAAGCTGCAATCTGGAGAA
CAGCAGTGGTCTATTCTGCGACCTCCGCCAGCCAGATGATTGTACAATAG
ATGACATTCTAACACCTGTAAATGCCTCAAACAGTTTCCCCGCTGACGAG
TTTGAGGTAGGATCGCAGTCGCAGGTGAATGAGTCGTCCCTTGACAAGGC
GAAGTCCGCGTCCACGGAGACCTGTGATGCCTCCGGCAGCAATCCCGCCA
CCAGACTGCTTAGTTCCATCAACGGAAGCTTTGTGGGGGAGGCCATTCAC
GCCGATGGCTCCGTCATAGAGGTAGTCTACTCCGTGCTCCTCCAGATACT
GCCCTGCTCCAACCGGGTGTACTGCATCTGGGTGTGCCGCAACCCCAGCA
CTCGGCTGGACGGTGAGAAGTACAACTATGCAAACCTAACGTCCACATTC
AACAGCATGGCCAGCACTGTTGAGCAGTCGCTGGGCCAGGTGATAAAGAC
CACCGCTGCCCAGAACTCCAGCAGACCCAATTCTCTGTCCTTGGTGTCCA
AGTACGAGGACGAATTGTACCTGGGCGACTACAGCAAATACTACACGTCC
ATCCGCCAGATCGGAAGAGGAGCCTATGGGTATGTGAATATGGCTTTCCG
GAACAGCGACCGCCTGCTGGTGATCACCAAGTTTATTCTCAAGGAGAAGC
TCTGCTCTCAGTTTATGGTTAAGAGCCGCGACTGCAAGGAAGTTCCTATC
GAGATCCACCTGCTGCAGACCCTGAACCACAAGAACATTGTGTCCGTTCT
CGATGTTTTCGAAAATGATCTATTCTACCAGCTGGTCATGGAGAAGCACG
GATCCGGAATGGATCTATGGACGTTCATAGAGCGGCGGCCCCTGATGGAC
GAAAAGCTGGGAAGCTACATTTTTCGTCAGGTGGCCGATGCCGTCAACTA
TCTGCACGAACAGAAGATACTGCATCGGGACATCAAGGACGAGAACATTA
TAATTGACCAGAACTTCACCATAAAGCTGATTGACTTCGGATCGGCGACC
TTCATGGAGGAGGGAAAATTCTTCTCCACGTTCTACGGCACGACGGAGTA
CTGCAGTCCGGAGGTTCTGGCCGGAAACAGATACGTGGGTCCCGAGCTGG
AGATTTGGGCCCTTGGTGTGACGCTTTACGTTCTGATGTTTTTCGAAAAT
CCATTCATCGATGTGGAGGAGACATTGAAGGCCGAGATTCAAATACCGAA
AGCTGTGTCCGAGCAATTGAGCCGTCTGTTGAGCTCCATGCTGAATAAGG
ATCCCAAGTACCGGTGCACCATGCACCAGTTAATCACAGATCCATGGCTC
ACCCAGGAGGTGAATCCCTCTACTTTCAGTTTCTCGTGGATAGTGCCGTG
CAAGGCCCACGAGGCCAATCCGAATCTGTATTTTTCCGGCTACCTATACT
CCAGTACTTCGGTGCTGTCCACTATTTCACCGCAGGAGAGCTTCTCCCAC
ATCGAGGAGTCCTCGATTGGGGGCAGCGATGACGCCAGATTAGCATCCCA
CAGAACCGGACACAAGTTGTGCGTTAATGAAGCCAAGCACAACAAAATGG
ACACTCTTTACGCGAAACAGTTCCAGCTAAACACCTCAGTGAGTAACCAC
GAGCTGAGGGTCTCGTTACCTGACTCAAGCCACACAGAAATCGGCGGTTC
AATATGCTCCTCGAAATCCGAGAACGATATATTCAAGAACAAGCTTCAGC
CCTGCGTCTCCACTTATAACGTAGTTAGTCTGCACGACGTGAGCACGAAA
CCCAAGAAGCTTGATCTGAAAGCAAGCTTTCTAGACCAT

BO10690.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
Pask-RA 2958 CG3105-PA 1..2955 17..2971 14775 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:13:18
Subject Length Description Subject Range Query Range Score Percent Strand
Pask-RA 3184 CG3105-RA 94..3048 17..2971 14775 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:13:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23988986..23991614 104..2732 13145 100 Plus
2R 25286936 2R 23991673..23991913 2731..2971 1205 100 Plus
2R 25286936 2R 23988831..23988918 17..104 440 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:13:16 has no hits.

BO10690.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:14 Download gff for BO10690.complete
Subject Subject Range Query Range Percent Splice Strand
CG3105-RA 115..3069 17..2973 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:04 Download gff for BO10690.complete
Subject Subject Range Query Range Percent Splice Strand
Pask-RA 94..3048 17..2973 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:13:29 Download gff for BO10690.complete
Subject Subject Range Query Range Percent Splice Strand
Pask-RA 94..3048 17..2973 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:13:29 Download gff for BO10690.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23991675..23991913 2733..2973 99   Plus
2R 23988987..23991614 105..2732 100 -> Plus
2R 23988831..23988918 17..104 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:04 Download gff for BO10690.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19879198..19879436 2733..2973 99   Plus
arm_2R 19876510..19879137 105..2732 100 -> Plus
arm_2R 19876354..19876441 17..104 100 -> Plus

BO10690.pep Sequence

Translation from 16 to 2989

> BO10690.pep
MEDQGDVTDQAAGKLSSSNAQCSRNRCANDDPIMGSHSQSRQNSSGMLNM
MDASSFSMPPPNLHSSKVINPNKAIFTIDANTGQIFIVNNKACQLLGYTS
QELRNKGFFDLLNGKTESHISSLAEMQIEGDEGRVVLLSGKVIEMKTKSG
GKILVSLWIRQISSDGRHIAVAEPVERHICHISTDRSGVITSVDSTTATI
FFYESVESVVGVSIVTLIPFIKLPDPDSREIPKSLRKQRATGRTTDNVKF
PLCLLIALDEDASAGYSHSGKTGLNITVWVFQNLSGLIVVDDIGNILMCN
QPFSLLMFGYGQDKIMNMHISAILPNFGKDSREEKSPNVSNTSITSNDWE
PDTDPLVVDNDSSLQSCKKSSTNRTAPNNEQSSVGDAHLSCNLENSSGLF
CDLRQPDDCTIDDILTPVNASNSFPADEFEVGSQSQVNESSLDKAKSAST
ETCDASGSNPATRLLSSINGSFVGEAIHADGSVIEVVYSVLLQILPCSNR
VYCIWVCRNPSTRLDGEKYNYANLTSTFNSMASTVEQSLGQVIKTTAAQN
SSRPNSLSLVSKYEDELYLGDYSKYYTSIRQIGRGAYGYVNMAFRNSDRL
LVITKFILKEKLCSQFMVKSRDCKEVPIEIHLLQTLNHKNIVSVLDVFEN
DLFYQLVMEKHGSGMDLWTFIERRPLMDEKLGSYIFRQVADAVNYLHEQK
ILHRDIKDENIIIDQNFTIKLIDFGSATFMEEGKFFSTFYGTTEYCSPEV
LAGNRYVGPELEIWALGVTLYVLMFFENPFIDVEETLKAEIQIPKAVSEQ
LSRLLSSMLNKDPKYRCTMHQLITDPWLTQEVNPSTFSFSWIVPCKAHEA
NPNLYFSGYLYSSTSVLSTISPQESFSHIEESSIGGSDDARLASHRTGHK
LCVNEAKHNKMDTLYAKQFQLNTSVSNHELRVSLPDSSHTEIGGSICSSK
SENDIFKNKLQPCVSTYNVVSLHDVSTKPKKLDLKASFLDH

BO10690.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
Pask-PA 985 CG3105-PA 1..985 1..985 5097 100 Plus
CG43143-PD 1180 CG11870-PD 73..328 579..835 376 32.7 Plus
CG43143-PG 1199 CG43143-PG 73..328 579..835 376 32.7 Plus
CG43143-PB 1427 CG11870-PB 73..328 579..835 376 32.7 Plus
CG43143-PC 1427 CG11870-PC 73..328 579..835 376 32.7 Plus