Clone BO11123 Report

Search the DGRC for BO11123

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:111
Well:23
Vector:pDNR-Dual
Associated Gene/TranscriptalphaCop-RA
Protein status:BO11123.pep: Imported from assembly
Sequenced Size:3736

Clone Sequence Records

BO11123.3prime Sequence

863 bp (698 high quality bases) assembled on 2006-04-19

> BO11123.3prime
ATGGTCTAGAAAGCTTGCGCGGAATTGCAGGTTTGAAATGCGCAGGCCAA
TGCTATCCTTGCCGATCTGGCTCACTTCGCAAACTGTGCAGAGATTGCCC
TTGAACTGAGGGTCGAAAGAGGAGGAGCAGAAGGGACAGGTCACTTCGGG
TTTACCCCTATACAGTGGCTTCCAGCTGATGCCGCAGATTGTGAACGGAT
TAAACTCCTCGTACTGCAGCTGATGCTCGTCCACGGGATTTACCTCGCAG
GCCTGCAGGATCTTGCGCACCTGCTGGGCAACGTCCGGTCGTGGCGCCAG
TTCCAGGAGACGACGGGCAAATGAGGCGGCCGTCTTGTAGTTCTTCAGCT
TGAAGAACATATTGAGGGCGGTACGCAGGGTGAGGATTTGGTGCACGGGC
TGAAGCTTGCAGTGCGTGAAGTAGGCGGCCATCTCGCACAGACGCTTTTG
CTCCTCAAGCGTCGACTTGGGCATGCCCTTGCGCACAGTCTCCATCTTCA
GGCCAACGATATACTCAGCGCAGATCCTTAAGAGTTGCTGGGCCTCCGCC
GCATCTAGCTTCGTGTCCACTACCAGCAGTGGGATGCTAATCAAGATGGA
ATGGAACTTCTCTACTGCCTCGGAGAACTTTCCAGAAGTTGTCAGTTGGT
ACCCAGCTTGCAGGCGTGCCACCAAATCATTCAGTTTAATGCCAACCGCA
GGACGCTGCAGCTTGATGTTTGTCTCGGAGTAGTTGCGAAGTGGGTAACC
ACTTAGGGATTGCAGATTCGGATTGGCCGTGTAGCTCGTTCGAGAGCAGG
CGTAGTTCTGCAGGAAGAGTGTCTTGAATGGCTGGAAATGACCACTCCCA
GCTGATCGTGCAG

BO11123.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG7961-PB 3705 alphaCop-RB 2882..3702 839..19 4105 100 Minus
CG7961-PA 3705 alphaCop-RA 2882..3702 839..19 4105 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
alphaCOP-RA 4078 CG7961-RA 3099..3944 863..19 4205 99.9 Minus
alphaCOP-RB 3970 CG7961-RB 2991..3836 863..19 4205 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 01:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1641200..1642045 19..863 4180 99.9 Plus
Blast to na_te.dros performed on 2015-02-12 01:40:52 has no hits.

BO11123.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 04:58:36 Download gff for BO11123.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7961-PA 2857..3705 18..863 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:19:20 Download gff for BO11123.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7961-PA 2857..3705 18..863 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 15:58:35 Download gff for BO11123.3prime
Subject Subject Range Query Range Percent Splice Strand
alphaCop-RB 2991..3836 19..863 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:37:04 Download gff for BO11123.3prime
Subject Subject Range Query Range Percent Splice Strand
alphaCOP-RB 2991..3836 19..863 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 06:37:04 Download gff for BO11123.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 1641200..1642045 19..863 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 15:58:35 Download gff for BO11123.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1641200..1642045 19..863 99   Plus

BO11123.5prime Sequence

842 bp (778 high quality bases) assembled on 2006-04-19

> BO11123.5prime
GAAGTTATCAGTCGACATGCTGACCAACTTCGAGTCGAAGTCGGCGAGGG
TGAAGGGCCTCTCCTTCCACCCTAAGCGCCCCTGGATCCTGGTCAGCTTG
CACAGCGGCGTCATCCAGCTGTGGGACTACCGGATGCACACGCTCCTCGA
GAAGTTCGACGAGCACGACGGACCGGTGCGAGGCGTGGCCTTCCACCAGC
AGATGCCGCTCTTCGTCTCTGGCGGCGACGACTACAAGATCAAGGTGTGG
AACTACAAGCAACGCCGATGCATTTTTACCCTCCTGGCCCATTTGGACTA
TGTGCGCACGGTGGCTTTCCACCACGAATACCCATGGATTCTGAGCGCCT
CCGACGATCAGACCATACGCATCTGGAACTGGCAGTCGCGCAACTGCATC
TGCGTGCTGACGGGCCACAACCACTATGTGATGTGCGCCCAGTTCCATCC
CACGGAGGATCAGATCGTTTCTGCTTCACTCGATCAGACGGTGCGCGTGT
GGGACATTTCGGGGCTGCGTAAGAAGAACGTGGCTCCCGGGCCCGGTGGG
CTTGATGACCACCTAAAGGGTCATCCGGGTGCCACTGATCTGTTTGGCCA
AGCAGATGCCGTGGTCAAGCACGTGCTCGAGGGCCACGACCGTGGCGTCA
ACTGGGCCAGTTTCCATCCCACCCTGCCGCTGATTGTCTCCGGTGCCGAT
GATCGCCTTGTGAAGTTGTGGCGCATGAACGAGTACAAGGCTTGGGAGGT
CGACACCTGTCGCGGTCACTACAACAACGTGTCCAGCGTGTTGTTCCATC
CCAGGCAAGACCTGATTCTCTTCAACGGCGAAGATCGCAGTA

BO11123.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG7961-PB 3705 alphaCop-RB 1..826 17..842 4105 99.8 Plus
CG7961-PA 3705 alphaCop-RA 1..826 17..842 4105 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:42:43
Subject Length Description Subject Range Query Range Score Percent Strand
alphaCOP-RA 4078 CG7961-RA 242..1068 16..842 4120 99.9 Plus
alphaCOP-RB 3970 CG7961-RB 134..960 16..842 4120 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1644132..1644958 842..16 4120 99.9 Minus
Blast to na_te.dros performed on 2015-02-12 11:42:40 has no hits.

BO11123.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 04:58:37 Download gff for BO11123.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7961-PA 1..825 17..841 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:19:21 Download gff for BO11123.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7961-PA 1..825 17..841 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 06:16:44 Download gff for BO11123.5prime
Subject Subject Range Query Range Percent Splice Strand
alphaCop-RB 126..959 10..841 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:41:35 Download gff for BO11123.5prime
Subject Subject Range Query Range Percent Splice Strand
alphaCOP-RB 126..959 10..841 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:41:35 Download gff for BO11123.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 1644133..1644966 10..841 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 06:16:44 Download gff for BO11123.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1644133..1644966 10..841 99   Minus

BO11123.complete Sequence

3736 bp assembled on 2010-09-13

GenBank Submission: KX797889

> BO11123.complete
GAAGTTATCAGTCGACATGCTGACCAACTTCGAGTCGAAGTCGGCGAGGG
TGAAGGGCCTCTCCTTCCACCCTAAGCGCCCCTGGATCCTGGTCAGCTTG
CACAGCGGCGTCATCCAGCTGTGGGACTACCGGATGCACACGCTCCTCGA
GAAGTTCGACGAGCACGACGGACCGGTGCGAGGCGTGGCCTTCCACCAGC
AGATGCCGCTCTTCGTCTCTGGCGGCGACGACTACAAGATCAAGGTGTGG
AACTACAAGCAACGCCGATGCATTTTTACCCTCCTGGCCCATTTGGACTA
TGTGCGCACGGTGGCTTTCCACCACGAATACCCATGGATTCTGAGCGCCT
CCGACGATCAGACCATACGCATCTGGAACTGGCAGTCGCGCAACTGCATC
TGCGTGCTGACGGGCCACAACCACTATGTGATGTGCGCCCAGTTCCATCC
CACGGAGGATCAGATCGTTTCTGCTTCACTCGATCAGACGGTGCGCGTGT
GGGACATTTCGGGGCTGCGTAAGAAGAACGTGGCTCCCGGGCCCGGTGGG
CTTGATGACCACCTAAAGGGTCATCCGGGTGCCACTGATCTGTTTGGCCA
AGCAGATGCCGTGGTCAAGCACGTGCTCGAGGGCCACGACCGTGGCGTCA
ACTGGGCCAGTTTCCATCCCACCCTGCCGCTGATTGTCTCCGGTGCCGAT
GATCGCCTTGTGAAGTTGTGGCGCATGAACGAGTACAAGGCTTGGGAGGT
CGACACCTGTCGCGGTCACTACAACAACGTGTCCAGCGTGTTGTTCCATC
CCAGGCAAGACCTGATTCTCTCCAACGGCGAAGATCGCAGTATTCGCGTC
TGGGACATGACCAAGCGCCAGTGCCTCTTTACATTCCGGCGGGACAACGA
GCGCTTCTGGATACTTACAGCGCATCCGACCCTGAATCTGTTTGCAGCTG
GCCACGATGGAGGTATGGTGGTCTTTAAACTGGAGCGAGAGCGTCCTGCA
TATGCTGTCCACGGGAATATTCTCTACTACGTCAAGGAACGTTTCCTTCG
CAAACTGGACTTTACCACCACTAAGGACACTGTGGTTATGCAGCTTCGAC
CAGGCAAGTCGCCGGTGTACAGCATGTCGTACAACCCAGCACTGAACGCC
GTGCTAATCTGCACGCGCACCAACAACCTGGAGAACAGCACCTACGATCT
TTGCCAAATCCCCAAGGACACCGAGAGCCAAAGTGAGTCGGACAGCAAGC
GAAGCTCTGGAATCACGGCCATCTGGGTGGCACGCAATCGGTTTGCAGTG
CTTGATCGCAACCAGCAGTTGGTGATCAAGAACTTCAAGAATGAGGTGAC
CAAGAAGTTGCCAACTTTCTGCGAGGAGATCTTCTATGCCGGTACGGGAA
TGCTGCTCATTCGGGACCCTGAGTTTGTCACACTGTACGAAGTTCAGCGC
CTAGTCTCCGTTGGAAGCATTAAACTGGCCAAGTGCCGCTACGTGGTGTG
GTCTCCGGACATGTCCTTGGTCGCTCTACTCTGCAAGCACTCGGTTACAA
TCTGCGACCGAAGACTTCAGTACTTGTGCACCGTGCAGGAGAACTGCCGC
GTGAAGTCTGGCGCCTGGGACGAGTCTGGAGTGTTTATCTACACCACTAG
CAACCACATTAAGTACGCCATTACAAACGGGGACCACGGCATCATCCGTA
CGCTGGACCTACCCATTTATCTGACACGCGTCAAGGGCAACCAAGTGTTC
TGCTTGGACCGGGAGTGCCGCACCCGTGTGCTCCACATCGATCCTACGGA
GTACAAGTTTAAGCTTGCCCTGATTCAACGCAAGTACGATGAAGTACTGC
ATATGGTGAGAAATGCCCGCCTAGTGGGTCAGAGCATCATTGCTTACCTG
CAGCAAAAGGGTTATCCAGAGGTGGCACTGCATTTTGTCAAGGATGAGAA
AACCCGATTTGGACTCGCTCTGGAGTGCGGTAACATCGAAATTGCTCTCG
AAGCAGCCAAGGCTCTCGATGACAAGGATTGCTGGGATCGCCTGGGACAG
AGTGCGCTGCTCCAAGGAAACCACCAGGTGGTAGAGATGTGCTACCAGCG
GACCAAGAACTTTGACAAGCTTAGCTTCCTCTACCTGATCACCGGCAACT
TGGAGAAGCTCAAGAAGATGAACAAGATTGCCGAGATTCGCAAGGATGTT
TCCGCCCAGTACCAGGGTGCCCTCCTTCTCGGTGACGTCAAGGAGCGGGT
AAACATCCTCAAAAACTGCGGACAACTTTCGTTAGCTTATCTCACAGCCG
CTACTCATGGATTCGATGAGCTCACTGAGTCCCTGGGCGAATCGATAACC
TCGCAGGGTAACAGCCTTCCCGAGGTGAATCCCAATGCCCAGTTGTTGCA
GCCACCAGTGCCCATCCAGCAGCTTGAAACCAATTGGCCGTTGCTGTCCG
TGTCCAAGGGCTTCTTTGAAGGCGCCATGGTCACCAGGGCTGGCTCCAGT
GCCACTGCCCGACAGGCGCTGAACATCAACGCCGATGCTGCACTGTTGGA
CGAGCATAATGGTGGTGGAGATGGTTGGGGAGCGGATGCCGACTTGGGAC
TAGATGAAGACGGAGATGACGAGATGCACGACGCGCTGAGCAACGATGGC
GATGGTGGTGCGGGTGGAGAGGAGGGTGCCGGCTGGGATGTGGGCGATGA
TGACCTGGTTGTGCCCGAGGAACTGGCCTCCAAGATCAAGGCCTCAGCCC
TCGACAGCAACTACTATGCGGCTCCCAACAAAGGCTTGTCTCCTGCCCAA
CAATGGGCCAACAACTCGCCTCTGGTCCTGGACCATGTCAAGGCCGGATC
ATTCGAAACCGCCTTCCGTTTACTGCACGATCAGCTGGGAGTGGTCAATT
TCCAGCCATTCAAGACACTCTTCCTGCAGAACTACGCCTGCTCTCGAACG
AGCTACACGGCCAATCCGAATCTGCAATCCCTAAGTGGTTACCCACTTCG
CAACTACTCCGAGACAAACATCAAGCTGCAGCGTCCTGCGGTTGGCATTA
AACTGAATGATTTGGTGGCACGCCTGCAAGCTGGGTACCAACTGACAACT
TCTGGAAAGTTCTCCGAGGCAGTAGAGAAGTTCCATTCCATCTTGATTAG
CATCCCACTGCTGGTAGTGGACACGAAGCTAGATGCGGCGGAGGCCCAGC
AACTCTTAAGGATCTGCGCTGAGTATATCGTTGGCCTGAAGATGGAGACT
GTGCGCAAGGGCATGCCCAAGTCGACGCTTGAGGAGCAAAAGCGTCTGTG
CGAGATGGCCGCCTACTTCACGCACTGCAAGCTTCAGCCCGTGCACCAAA
TCCTCACCCTGCGTACCGCCCTCAATATGTTCTTCAAGCTGAAGAACTAC
AAGACGGCCGCCTCATTTGCCCGTCGTCTCCTGGAACTGGCGCCACGACC
GGACGTTGCCCAGCAGGTGCGCAAGATCCTGCAGGCCTGCGAGGTAAATC
CCGTGGACGAGCATCAGCTGCAGTACGAGGAGTTTAATCCGTTCACAATC
TGCGGCATCAGCTGGAAGCCACTGTATAGGGGTAAACCCGAAGTGACCTG
TCCCTTCTGCTCCTCCTCTTTCGACCCTCAGTTCAAGGGCAATCTCTGCA
CAGTTTGCGAAGTGAGCCAGATCGGCAAGGATAGCATTGGCCTGCGCATT
TCAAACCTGCAATTCCGCGCAAGCTTTCTAGACCAT

BO11123.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:13:43
Subject Length Description Subject Range Query Range Score Percent Strand
alphaCOP-RA 3705 CG7961-PA 1..3702 17..3718 18510 100 Plus
alphaCOP-RB 3705 CG7961-PB 1..3702 17..3718 18510 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:13:46
Subject Length Description Subject Range Query Range Score Percent Strand
alphaCOP-RA 4078 CG7961-RA 242..3944 16..3718 18515 100 Plus
alphaCOP-RB 3970 CG7961-RB 134..3836 16..3718 18515 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1641200..1643957 3718..961 13790 100 Minus
3L 28110227 3L 1644010..1644958 964..16 4745 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:13:42 has no hits.

BO11123.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:16 Download gff for BO11123.complete
Subject Subject Range Query Range Percent Splice Strand
alphaCop-RA 136..3837 17..3720 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:09 Download gff for BO11123.complete
Subject Subject Range Query Range Percent Splice Strand
alphaCop-RB 135..3836 17..3720 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:13:37 Download gff for BO11123.complete
Subject Subject Range Query Range Percent Splice Strand
alphaCOP-RB 135..3836 17..3720 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:13:37 Download gff for BO11123.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1644012..1644957 17..962 100   Minus
3L 1641198..1643955 963..3720 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:09 Download gff for BO11123.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1644012..1644957 17..962 100   Minus
arm_3L 1641198..1643955 963..3720 99 <- Minus

BO11123.pep Sequence

Translation from 16 to 3736

> BO11123.pep
MLTNFESKSARVKGLSFHPKRPWILVSLHSGVIQLWDYRMHTLLEKFDEH
DGPVRGVAFHQQMPLFVSGGDDYKIKVWNYKQRRCIFTLLAHLDYVRTVA
FHHEYPWILSASDDQTIRIWNWQSRNCICVLTGHNHYVMCAQFHPTEDQI
VSASLDQTVRVWDISGLRKKNVAPGPGGLDDHLKGHPGATDLFGQADAVV
KHVLEGHDRGVNWASFHPTLPLIVSGADDRLVKLWRMNEYKAWEVDTCRG
HYNNVSSVLFHPRQDLILSNGEDRSIRVWDMTKRQCLFTFRRDNERFWIL
TAHPTLNLFAAGHDGGMVVFKLERERPAYAVHGNILYYVKERFLRKLDFT
TTKDTVVMQLRPGKSPVYSMSYNPALNAVLICTRTNNLENSTYDLCQIPK
DTESQSESDSKRSSGITAIWVARNRFAVLDRNQQLVIKNFKNEVTKKLPT
FCEEIFYAGTGMLLIRDPEFVTLYEVQRLVSVGSIKLAKCRYVVWSPDMS
LVALLCKHSVTICDRRLQYLCTVQENCRVKSGAWDESGVFIYTTSNHIKY
AITNGDHGIIRTLDLPIYLTRVKGNQVFCLDRECRTRVLHIDPTEYKFKL
ALIQRKYDEVLHMVRNARLVGQSIIAYLQQKGYPEVALHFVKDEKTRFGL
ALECGNIEIALEAAKALDDKDCWDRLGQSALLQGNHQVVEMCYQRTKNFD
KLSFLYLITGNLEKLKKMNKIAEIRKDVSAQYQGALLLGDVKERVNILKN
CGQLSLAYLTAATHGFDELTESLGESITSQGNSLPEVNPNAQLLQPPVPI
QQLETNWPLLSVSKGFFEGAMVTRAGSSATARQALNINADAALLDEHNGG
GDGWGADADLGLDEDGDDEMHDALSNDGDGGAGGEEGAGWDVGDDDLVVP
EELASKIKASALDSNYYAAPNKGLSPAQQWANNSPLVLDHVKAGSFETAF
RLLHDQLGVVNFQPFKTLFLQNYACSRTSYTANPNLQSLSGYPLRNYSET
NIKLQRPAVGIKLNDLVARLQAGYQLTTSGKFSEAVEKFHSILISIPLLV
VDTKLDAAEAQQLLRICAEYIVGLKMETVRKGMPKSTLEEQKRLCEMAAY
FTHCKLQPVHQILTLRTALNMFFKLKNYKTAASFARRLLELAPRPDVAQQ
VRKILQACEVNPVDEHQLQYEEFNPFTICGISWKPLYRGKPEVTCPFCSS
SFDPQFKGNLCTVCEVSQIGKDSIGLRISNLQFRASFLDH

BO11123.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:27:54
Subject Length Description Subject Range Query Range Score Percent Strand
alphaCOP-PA 1234 CG7961-PA 1..1234 1..1234 6525 100 Plus
alphaCOP-PB 1234 CG7961-PB 1..1234 1..1234 6525 100 Plus
beta'COP-PA 914 CG6699-PA 13..792 7..786 669 25.9 Plus
Lis-1-PG 411 CG8440-PG 109..376 10..289 297 27.4 Plus
Lis-1-PF 411 CG8440-PF 109..376 10..289 297 27.4 Plus
Lis-1-PG 411 CG8440-PG 306..409 60..163 235 38.5 Plus
Lis-1-PG 411 CG8440-PG 306..408 18..120 203 35 Plus