Clone BO17844 Report

Search the DGRC for BO17844

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:178
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptCG4877-RA
Protein status:BO17844.pep: Imported from assembly
Sequenced Size:3385

Clone Sequence Records

BO17844.complete Sequence

3385 bp assembled on 2010-10-15

GenBank Submission: KX798102

> BO17844.complete
GAAGTTATCAGTCGACATGTCCAACGAGATCTACGACTCCTCCAATTCGC
AGCTAAGTAGCGACGAGTATAGCCACGAGGAGGAGGAATACGACGCTCTA
ATGGACGCGGCGGTGAGCAAGCAACGACCCCAAAAGACAAAATCCAAGGG
ATCCGAGTCCGAGAAACCCGGAAATGGAGCTCCAGAATCGGCGGCTGCCA
CTGAGAAAAATGAAAAGCCAGATGACGATGCGGTGCCACCTTCCACGCGC
TCAGAAACAATTCGGCGGATCCGGCAATTGCAGTTACAGCGTGGCAGGCT
GCCCAATCTTTACTTCAAGCGTCGCAGTATTCGTTGGCTGCGACCCAATA
AAATGGACTACAACAGCTATTTTGACGGCCTGAAGGACTTGCTGCCCAAG
CGTAAATTGAAGCACCTGGTTCGCTTCCATGACAGGCAGCGCAGAACCTA
CGACAGCAGGAGCATCAGTCGTAGTCGCAGCCACAGCCGCAGTCTTAGCC
GAAGTTGCAGTCGCAGTCGTAGTCGTAGCTATTCTCGCAGCCGCAGCGGC
AGTGGTTCGCCGGAACTCATTTGCCTTGACGACACGGAGAACGAGGATTC
GCCTGAGAAACCAGAGCAAGAGCCGGCAAGGGTTACGCCCATCAAGGAAA
ATAAGCCTACGCTTCCGGCTCCACCCCAACTAAACTACGAGCTGCCAGAA
AGGAAGAAAGCAAACCCACTTGGAAACAACGAAAACGGTGCCTCTATCCT
CGACGAGTTCCTGGTAAAGAAGGATCCCCAGGAACCGGTCTTCGACTACG
GTAAACTCTCAGCGTGTCGGGAATTGGAACAGGCTCTAAAGGACCGGTCG
CGAGATGCGCCAAATGAGGCAGAGTCGCTTGTGGTTGATGCCACTCTTAA
AAGACGCCGTTCGGTAACACCGCCCGCTAGCGAAGAGAAGCGCAACAATG
AAGTCGAGGATGATAATATAATTGGGTTTTCAACGGTGCAGCAACAGAAG
CCAATGGAGGCAGCTCCACCATTAAATCTAAGAATGCCCACCACTCCATC
GACTAATCCTCTTCAGCGTCAGCAGGCTTTTAAGCTGAGCACACCGTATA
CCCTGGCTCCGCCTACTGCCGCCAAGCAAGCTGACACTTACAGTTTAAAT
ACTCCACCGCCAACGGCCACCCAAATGCAGATATCCTATCCCAACGAAAA
GCTGTCAAATAACATGAAAGCTAATGCGACTTTCTCGATTCAACAGACAG
CTTTATCCCAAGTCGCTGCATCCTATGCTGCTGCACCACAAGTGGCTGCC
CTCGCGCAGAGAGCTCCATCTCAGGTTGCTCCACTACAACAAGCCCCCGT
GCAACAGATGCACTTCCCAAGATCAGTTCCACCGCAGCAGCTTCCTCCAC
CACAGCAGCGAGCTCCTCCACAGCAACTGGCTACAGCTCCATTCGCTCCA
CCACGGCACCTGGCTCAACATAGACCATCTCCACAGCAGCTAGCTCCATC
ACAGCAGCTGGCTCCACCACACCAGCTAGCTCCACCACACCAGCTAGCTC
CACCACAGCAGCGAGCTCCGCCACAGCAGCTAGCTCCACCACACCAGCTA
GCTCCACCACACCAGCTAGCTCCACCACAGCAGCGAGCTCCGCCACAGCA
GCTAGCTCCGCCACAGCAGCTAGCTCCACCACAGCAGCTAGCTCCACCAC
AGCAGCTAGCTCCACCACAGCAGCTAGCTCCACCACAGCAGCGAGCTCCG
CCACAGCAGCGAGCTCCGCCACAGCAGCTGGCTCCGCCACAACAGCGAGC
TCCCACACAGCATATGGCTCCACCACAACATATGGCTCCGCCACAGCAGC
TAGCTCCAACACAGCAGCTAGCTCCTCCACCACAGCAGCTAGCGCCTCGA
CCACAGCAGCTAGCTCCTCCACCACAGCAACTAGCTCCTCCACCACAGCA
GCTAGCTCCTCCACCACAGCAGCCAGATTCATCAAGACCAGCTTCGGTGC
AGCCGTTGACCCCTCAAAGGCATGCTAGTCCACATCAGCTTGCCCAATCA
CAGCAGGTCCATCAATCGCCATCTCAACTGCATCCTGTTCCAGTGGCTGC
TCCCAACTTTGCGGTGCCCCAACAGCCGCAACCCCGTCGATCGGAAACGG
TGAGCACCCAGACGCAGGGCTTGGGGTCACCAGCGGCTTCTTCTTCGACA
ACCCGCCAAAAGTCATTCGTTGATCTCAATAATAGTGATGCAAACTTCCA
TTATCGCGTCAAAGAACTTTTCGATGAATTGAACTCGACAATGATTGATA
AAATTAACTCGGTACCCCCTGATGAAGATTCATTGAAAAAAGAGCGCGAA
CGCATCGTTGCGGATCTTGCAGCCCTAGATAAGCTGATGGCCCAGAAAGA
GGATGAATATAACCGACTGCTGTATTTGAGCTGCATTAAGAAGGAGCTGC
ATGAACGAATGGAGCGAAAGGAGCGCTTGATACGTATTAAGGACCTACTG
CCCATCCTTATCAACAAGTGCGGCACCAAGGAGCTCAGTGAGGTAAAGGC
TATGCTAGAAGAGGAAATCGATTCTCCAATGGCCTCCAAACATAGTTTGT
CGGCAATTGAAAAATTACTGAATTACGCCGAGTTAAACCAGAACATCATA
CAGCTTCTGCGGGGTTCCTTGGGCTTAAATAAACGCGCACCGTCCGTGTC
TCCGGCCAATTTCGAGGATGACCAAATGCTTTTTCGTAGAGATTCCTTGC
CCGTAAGTCATCTATCAATGCGGGATCAGCATTACGAATCTCGGAATGCG
GTAAATGACCATCTGCTAGATAGCAATCCAGACAGAGATCCGCCAGCCAA
GCGACCGAAGCTAATCCACTCGCAAGACAGTAACCAGGACATGGCAAGCT
CCTCGACACATTTGTCAGCCAATCTTTCAGAGACGCTTCGCAAGATTAGG
GCTTGGAAAAATTATTCGCATTTTAGTAACGTCTCAATGGAGGACAATAA
TTCGGATAATGAATCACAGATCGAACCGCTGTTCAACAGCAGTCCGATGG
CCTCCCGTCGCCAACTGGCCAATAGACAGTCCTACCAAGAACAACATTCC
GCTAATATCAACGACCATGAGAATGTCCAAAAGAGGCACAAGTCTCACAA
GCGCAAGTCGCATAAGCACAAGTCTCACAAGCATAGGAGCTCCCATAAGT
CCCAGGCTGAATCTTCCGCCACCATCAACGGTAACACAGGTAGACAATGC
CACGAGTGCAAGCTCTATGGAGCCACCTTTATGTGCTCCAACTGTCAGAA
TCAATGGTACTGCAGTCGTGAATGCCAGCTGAGCGATTGGGACACACATC
ACCGAACTTGTGGCATTGCAAGCTTTCTAGACCAT

BO17844.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
RAF2-RC 3354 CG4877-PC 1..3351 17..3367 16755 100 Plus
RAF2-RA 3354 CG4877-PA 1..3351 17..3367 16755 100 Plus
RAF2-RB 3354 CG4877-PB 1..3351 17..3367 16755 100 Plus
RAF2-RC 3354 CG4877-PC 1465..1913 1517..1971 1335 87.3 Plus
RAF2-RA 3354 CG4877-PA 1465..1913 1517..1971 1335 87.3 Plus
RAF2-RC 3354 CG4877-PC 1519..1955 1481..1929 1230 85.8 Plus
RAF2-RA 3354 CG4877-PA 1519..1955 1481..1929 1230 85.8 Plus
RAF2-RC 3354 CG4877-PC 1465..1894 1553..1973 1105 84.8 Plus
RAF2-RA 3354 CG4877-PA 1465..1894 1553..1973 1105 84.8 Plus
RAF2-RC 3354 CG4877-PC 1465..1780 1571..1886 1070 89.2 Plus
RAF2-RA 3354 CG4877-PA 1465..1780 1571..1886 1070 89.2 Plus
RAF2-RC 3354 CG4877-PC 1465..1756 1589..1880 965 88.7 Plus
RAF2-RA 3354 CG4877-PA 1465..1756 1589..1880 965 88.7 Plus
RAF2-RC 3354 CG4877-PC 1465..1738 1607..1880 920 89.1 Plus
RAF2-RA 3354 CG4877-PA 1465..1738 1607..1880 920 89.1 Plus
RAF2-RC 3354 CG4877-PC 1465..1720 1625..1880 815 87.9 Plus
RAF2-RA 3354 CG4877-PA 1465..1720 1625..1880 815 87.9 Plus
RAF2-RC 3354 CG4877-PC 1465..1738 1643..1922 775 86.8 Plus
RAF2-RC 3354 CG4877-PC 1465..1720 1661..1922 775 88.2 Plus
RAF2-RA 3354 CG4877-PA 1465..1738 1643..1922 775 86.8 Plus
RAF2-RA 3354 CG4877-PA 1465..1720 1661..1922 775 88.2 Plus
RAF2-RC 3354 CG4877-PC 1465..1738 1679..1964 705 86.4 Plus
RAF2-RA 3354 CG4877-PA 1465..1738 1679..1964 705 86.4 Plus
RAF2-RC 3354 CG4877-PC 1465..1720 1697..1964 570 84.3 Plus
RAF2-RA 3354 CG4877-PA 1465..1720 1697..1964 570 84.3 Plus
RAF2-RC 3354 CG4877-PC 1465..1702 1715..1964 495 83.6 Plus
RAF2-RA 3354 CG4877-PA 1465..1702 1715..1964 495 83.6 Plus
RAF2-RC 3354 CG4877-PC 1465..1684 1733..1964 360 81 Plus
RAF2-RC 3354 CG4877-PC 1465..1666 1751..1964 360 82.2 Plus
RAF2-RA 3354 CG4877-PA 1465..1684 1733..1964 360 81 Plus
RAF2-RA 3354 CG4877-PA 1465..1666 1751..1964 360 82.2 Plus
RAF2-RC 3354 CG4877-PC 1465..1648 1769..1964 255 80.1 Plus
RAF2-RC 3354 CG4877-PC 1465..1630 1787..1964 255 81.5 Plus
RAF2-RA 3354 CG4877-PA 1465..1648 1769..1964 255 80.1 Plus
RAF2-RA 3354 CG4877-PA 1465..1630 1787..1964 255 81.5 Plus
RAF2-RC 3354 CG4877-PC 1466..1612 1806..1964 205 81.1 Plus
RAF2-RA 3354 CG4877-PA 1466..1612 1806..1964 205 81.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:01:30
Subject Length Description Subject Range Query Range Score Percent Strand
RAF2-RC 4076 CG4877-RC 250..3600 17..3367 16755 100 Plus
RAF2-RA 4082 CG4877-RA 256..3606 17..3367 16755 100 Plus
RAF2-RB 4006 CG4877-RB 180..3530 17..3367 16755 100 Plus
RAF2-RC 4076 CG4877-RC 1714..2162 1517..1971 1335 87.3 Plus
RAF2-RA 4082 CG4877-RA 1720..2168 1517..1971 1335 87.3 Plus
RAF2-RC 4076 CG4877-RC 1768..2204 1481..1929 1230 85.8 Plus
RAF2-RA 4082 CG4877-RA 1774..2210 1481..1929 1230 85.8 Plus
RAF2-RC 4076 CG4877-RC 1714..2143 1553..1973 1105 84.8 Plus
RAF2-RA 4082 CG4877-RA 1720..2149 1553..1973 1105 84.8 Plus
RAF2-RC 4076 CG4877-RC 1714..2029 1571..1886 1070 89.2 Plus
RAF2-RA 4082 CG4877-RA 1720..2035 1571..1886 1070 89.2 Plus
RAF2-RC 4076 CG4877-RC 1714..2005 1589..1880 965 88.7 Plus
RAF2-RA 4082 CG4877-RA 1720..2011 1589..1880 965 88.7 Plus
RAF2-RC 4076 CG4877-RC 1714..1987 1607..1880 920 89.1 Plus
RAF2-RA 4082 CG4877-RA 1720..1993 1607..1880 920 89.1 Plus
RAF2-RC 4076 CG4877-RC 1714..1969 1625..1880 815 87.9 Plus
RAF2-RA 4082 CG4877-RA 1720..1975 1625..1880 815 87.9 Plus
RAF2-RC 4076 CG4877-RC 1714..1987 1643..1922 775 86.8 Plus
RAF2-RC 4076 CG4877-RC 1714..1969 1661..1922 775 88.2 Plus
RAF2-RA 4082 CG4877-RA 1720..1993 1643..1922 775 86.8 Plus
RAF2-RA 4082 CG4877-RA 1720..1975 1661..1922 775 88.2 Plus
RAF2-RC 4076 CG4877-RC 1714..1987 1679..1964 705 86.4 Plus
RAF2-RA 4082 CG4877-RA 1720..1993 1679..1964 705 86.4 Plus
RAF2-RC 4076 CG4877-RC 1714..1969 1697..1964 570 84.3 Plus
RAF2-RA 4082 CG4877-RA 1720..1975 1697..1964 570 84.3 Plus
RAF2-RC 4076 CG4877-RC 1714..1951 1715..1964 495 83.6 Plus
RAF2-RA 4082 CG4877-RA 1720..1957 1715..1964 495 83.6 Plus
RAF2-RC 4076 CG4877-RC 1714..1933 1733..1964 360 81 Plus
RAF2-RC 4076 CG4877-RC 1714..1915 1751..1964 360 82.2 Plus
RAF2-RA 4082 CG4877-RA 1720..1939 1733..1964 360 81 Plus
RAF2-RA 4082 CG4877-RA 1720..1921 1751..1964 360 82.2 Plus
RAF2-RC 4076 CG4877-RC 1714..1897 1769..1964 255 80.1 Plus
RAF2-RC 4076 CG4877-RC 1714..1879 1787..1964 255 81.5 Plus
RAF2-RA 4082 CG4877-RA 1720..1903 1769..1964 255 80.1 Plus
RAF2-RA 4082 CG4877-RA 1720..1885 1787..1964 255 81.5 Plus
RAF2-RC 4076 CG4877-RC 1715..1861 1806..1964 205 81.1 Plus
RAF2-RA 4082 CG4877-RA 1721..1867 1806..1964 205 81.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:01:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16387020..16389348 336..2664 11645 100 Plus
3L 28110227 3L 16386637..16386957 17..337 1605 100 Plus
3L 28110227 3L 16388165..16388613 1517..1971 1335 87.3 Plus
3L 28110227 3L 16389933..16390184 3077..3328 1260 100 Plus
3L 28110227 3L 16388219..16388655 1481..1929 1230 85.8 Plus
3L 28110227 3L 16388165..16388594 1553..1973 1105 84.8 Plus
3L 28110227 3L 16389404..16389620 2664..2880 1085 100 Plus
3L 28110227 3L 16388165..16388480 1571..1886 1070 89.2 Plus
3L 28110227 3L 16389677..16389877 2879..3079 1005 100 Plus
3L 28110227 3L 16388165..16388456 1589..1880 965 88.7 Plus
3L 28110227 3L 16388165..16388438 1607..1880 920 89.1 Plus
3L 28110227 3L 16388165..16388420 1625..1880 815 87.9 Plus
3L 28110227 3L 16388165..16388438 1643..1922 775 86.8 Plus
3L 28110227 3L 16388165..16388420 1661..1922 775 88.2 Plus
3L 28110227 3L 16388165..16388438 1679..1964 705 86.4 Plus
3L 28110227 3L 16388165..16388420 1697..1964 570 84.3 Plus
3L 28110227 3L 16388165..16388402 1715..1964 495 83.6 Plus
3L 28110227 3L 16388165..16388384 1733..1964 360 81 Plus
3L 28110227 3L 16388165..16388366 1751..1964 360 82.2 Plus
3L 28110227 3L 16388165..16388348 1769..1964 255 80.1 Plus
3L 28110227 3L 16388165..16388330 1787..1964 255 81.5 Plus
3L 28110227 3L 16388166..16388312 1806..1964 205 81.1 Plus
3L 28110227 3L 16390300..16390340 3327..3367 205 100 Plus
Blast to na_te.dros performed 2014-11-26 15:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6680..7083 1574..1977 291 58.7 Plus

BO17844.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:22:59 Download gff for BO17844.complete
Subject Subject Range Query Range Percent Splice Strand
CG4877-RA 238..3588 17..3369 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:13 Download gff for BO17844.complete
Subject Subject Range Query Range Percent Splice Strand
RAF2-RB 180..3530 17..3369 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:04:55 Download gff for BO17844.complete
Subject Subject Range Query Range Percent Splice Strand
RAF2-RB 180..3530 17..3369 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:04:55 Download gff for BO17844.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16390302..16390340 3329..3369 95   Plus
3L 16389936..16390184 3080..3328 100 -> Plus
3L 16389679..16389877 2881..3079 100 -> Plus
3L 16389405..16389620 2665..2880 100 -> Plus
3L 16387021..16389348 337..2664 100 -> Plus
3L 16386637..16386956 17..336 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:13 Download gff for BO17844.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16383402..16383440 3329..3369 95   Plus
arm_3L 16383036..16383284 3080..3328 100 -> Plus
arm_3L 16382779..16382977 2881..3079 100 -> Plus
arm_3L 16382505..16382720 2665..2880 100 -> Plus
arm_3L 16380121..16382448 337..2664 100 -> Plus
arm_3L 16379737..16380056 17..336 100 -> Plus

BO17844.3prime Sequence

698 bp (567 high quality bases) assembled on 2006-10-13

> BO17844.3prime
ATGGTCTAGAAAGCTTGCAATGCCACAAGTTCGGTGATGTGTGTCCCAAT
CGCTCAGCTGGCATTCACGACTGCAGTACCATTGATTCTGACAGTTGGAG
CACATAAAGGTGGCTCCATAGAGCTTGCACTCGTGGCATTGTCTACCTGT
GTTACCGTTGATGGTGGCGGAAGATTCAGCCTGGGACTTATGGGAGCTCC
TATGCTTGTGAGACTTGTGCTTATGCGACTTGCGCTTGTGAGACTTGTGC
CTCTTTTGGACATTCTCATGGTCGTTGATATTAGCGGAATGTTGTTCTTG
GTAGGACTGTCTATTGGCCAGTTGGCGACGGGAGGCCATCGGACTGCTGT
TGAACAGCGGTTCGATCTGTGATTCATTATCCGAATTATTGTCCTCCATT
GAGACGTTACTAAAATGCGAATAATTTTTCCAAGCCCTAATCTTGCGAAG
CGTCTCTGAAAGATTGGCTGACAAATGTGTCGAGGAGCTTGCCATGTCCT
GGTTACTGTCTTGCGAGTGGATTAGCTTCGGTCGCTTGGCTGGCGGATCT
CTGTCTGGATTGCTATCTAGCAGATGGTCATTTACCGCATTCCGAGATTC
GTAATGCTGATCCCGCATTGATAGATGACTTACGGGCAAGGAATCTCTAC
GAAAAAGCATTTGGCCATCCTCGAAATTGGCGGGAGACACGGACGGTG

BO17844.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 18:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG4877-PB 3354 CG4877-RB 2672..3351 698..19 3350 99.7 Minus
CG4877-PA 3354 CG4877-RA 2672..3351 698..19 3350 99.7 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:01:30
Subject Length Description Subject Range Query Range Score Percent Strand
RAF2-RC 4076 CG4877-RC 2921..3600 698..19 3370 99.7 Minus
RAF2-RA 4082 CG4877-RA 2927..3606 698..19 3370 99.7 Minus
RAF2-RB 4006 CG4877-RB 2851..3530 698..19 3370 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16389933..16390184 309..58 1260 100 Minus
3L 28110227 3L 16389677..16389877 507..307 1005 100 Minus
3L 28110227 3L 16389428..16389620 698..506 935 99 Minus
3L 28110227 3L 16390300..16390340 59..19 205 100 Minus
Blast to na_te.dros performed on 2015-02-13 16:01:29 has no hits.

BO17844.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:14:10 Download gff for BO17844.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4877-PA 2672..3354 15..698 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 12:38:40 Download gff for BO17844.3prime
Subject Subject Range Query Range Percent Splice Strand
RAF2-RB 2851..3533 15..698 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:37:53 Download gff for BO17844.3prime
Subject Subject Range Query Range Percent Splice Strand
RAF2-RB 2851..3533 15..698 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:37:53 Download gff for BO17844.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 16390302..16390343 15..57 95   Minus
3L 16389936..16390184 58..306 100 -> Minus
3L 16389679..16389877 307..505 100 -> Minus
3L 16389428..16389620 506..698 98 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 12:38:40 Download gff for BO17844.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16383402..16383443 15..57 95   Minus
arm_3L 16383036..16383284 58..306 100 -> Minus
arm_3L 16382779..16382977 307..505 100 -> Minus
arm_3L 16382528..16382720 506..698 98 -> Minus

BO17844.5prime Sequence

715 bp (631 high quality bases) assembled on 2006-10-13

> BO17844.5prime
GAAGTTATCAGTCGACATGTCCAACGAGATCTACGACTCCTCCAATTCGC
AGCTAAGTAGCGACGAGTATAGCCACGAGGAGGAGGAATACGACGCTCTA
ATGGACGCGGCGGTGAGCAAGCAACGACCCCAAAAGACAAAATCCAAGGG
ATCCGAGTCCGAGAAACCCGGAAATGGAGCTCCAGAATCGGCGGCTGCCA
CTGAGAAAAATGAAAAGCCAGATGACGATGCGGTGCCACCTTCCACGCGC
TCAGAAACAATTCGGCGGATCCGGCAATTGCAGTTACAGCGTGGCAGGCT
GCCCAATCTTTACTTCAAGCGTCGCAGTATTCGTTGGCTGCGACCCAATA
AAATGGACTACAACAGCTATTTTGACGGCCTGAAGGACTTGCTGCCCAAG
CGTAAATTGAAGCACCTGGTTCGCTTCCATGACAGGCAGCGCAGAACCTA
CGACAGCAGGAGCATCAGTCGTAGTCGCAGCCACAGCCGCAGTCTTAGCC
GAAGTTGCAGTCGCAGTCGTAGTCGTAGCTATTCTCGCAGCCGCAGCGGC
AGTGGTTCGCCGGAACTCATTTGCCTTGACGACACGGAGAACGAGGATTC
GCCTGAGAAACCAGAGCAAGAGCCGGCAAGGGTTACGCCCATCAAGGAAA
ATAAGCCTACGCTTCCGGCTCCACCCCAACTAAACTACGAGCTGCCAGAA
AGGAAGAAAGCAAAC

BO17844.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 18:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG4877-PB 3354 CG4877-RB 1..699 17..715 3495 100 Plus
CG4877-PA 3354 CG4877-RA 1..699 17..715 3495 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:04:55
Subject Length Description Subject Range Query Range Score Percent Strand
RAF2-RC 4076 CG4877-RC 250..948 17..715 3495 100 Plus
RAF2-RA 4082 CG4877-RA 256..954 17..715 3495 100 Plus
RAF2-RB 4006 CG4877-RB 180..878 17..715 3495 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 22:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16387020..16387399 336..715 1900 100 Plus
3L 28110227 3L 16386637..16386957 17..337 1605 100 Plus
Blast to na_te.dros performed on 2015-02-10 22:04:52 has no hits.

BO17844.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:14:11 Download gff for BO17844.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4877-PA 1..699 17..715 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 13:50:26 Download gff for BO17844.5prime
Subject Subject Range Query Range Percent Splice Strand
RAF2-RB 180..878 17..715 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:55:16 Download gff for BO17844.5prime
Subject Subject Range Query Range Percent Splice Strand
RAF2-RB 180..878 17..715 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:55:16 Download gff for BO17844.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 16387021..16387399 337..715 100   Plus
3L 16386637..16386956 17..336 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 13:50:26 Download gff for BO17844.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16380121..16380499 337..715 100   Plus
arm_3L 16379737..16380056 17..336 100 -> Plus

BO17844.pep Sequence

Translation from 16 to 3385

> BO17844.pep
MSNEIYDSSNSQLSSDEYSHEEEEYDALMDAAVSKQRPQKTKSKGSESEK
PGNGAPESAAATEKNEKPDDDAVPPSTRSETIRRIRQLQLQRGRLPNLYF
KRRSIRWLRPNKMDYNSYFDGLKDLLPKRKLKHLVRFHDRQRRTYDSRSI
SRSRSHSRSLSRSCSRSRSRSYSRSRSGSGSPELICLDDTENEDSPEKPE
QEPARVTPIKENKPTLPAPPQLNYELPERKKANPLGNNENGASILDEFLV
KKDPQEPVFDYGKLSACRELEQALKDRSRDAPNEAESLVVDATLKRRRSV
TPPASEEKRNNEVEDDNIIGFSTVQQQKPMEAAPPLNLRMPTTPSTNPLQ
RQQAFKLSTPYTLAPPTAAKQADTYSLNTPPPTATQMQISYPNEKLSNNM
KANATFSIQQTALSQVAASYAAAPQVAALAQRAPSQVAPLQQAPVQQMHF
PRSVPPQQLPPPQQRAPPQQLATAPFAPPRHLAQHRPSPQQLAPSQQLAP
PHQLAPPHQLAPPQQRAPPQQLAPPHQLAPPHQLAPPQQRAPPQQLAPPQ
QLAPPQQLAPPQQLAPPQQLAPPQQRAPPQQRAPPQQLAPPQQRAPTQHM
APPQHMAPPQQLAPTQQLAPPPQQLAPRPQQLAPPPQQLAPPPQQLAPPP
QQPDSSRPASVQPLTPQRHASPHQLAQSQQVHQSPSQLHPVPVAAPNFAV
PQQPQPRRSETVSTQTQGLGSPAASSSTTRQKSFVDLNNSDANFHYRVKE
LFDELNSTMIDKINSVPPDEDSLKKERERIVADLAALDKLMAQKEDEYNR
LLYLSCIKKELHERMERKERLIRIKDLLPILINKCGTKELSEVKAMLEEE
IDSPMASKHSLSAIEKLLNYAELNQNIIQLLRGSLGLNKRAPSVSPANFE
DDQMLFRRDSLPVSHLSMRDQHYESRNAVNDHLLDSNPDRDPPAKRPKLI
HSQDSNQDMASSSTHLSANLSETLRKIRAWKNYSHFSNVSMEDNNSDNES
QIEPLFNSSPMASRRQLANRQSYQEQHSANINDHENVQKRHKSHKRKSHK
HKSHKHRSSHKSQAESSATINGNTGRQCHECKLYGATFMCSNCQNQWYCS
RECQLSDWDTHHRTCGIASFLDH

BO17844.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:10:18
Subject Length Description Subject Range Query Range Score Percent Strand
RAF2-PC 1117 CG4877-PC 1..1117 1..1117 5855 100 Plus
RAF2-PA 1117 CG4877-PA 1..1117 1..1117 5855 100 Plus
RAF2-PB 1117 CG4877-PB 1..1117 1..1117 5855 100 Plus
Wnk-PN 2441 CG7177-PN 1027..1443 324..711 295 29.1 Plus
Wnk-PL 2441 CG7177-PL 1027..1443 324..711 295 29.1 Plus
Wnk-PN 2441 CG7177-PN 794..1370 244..717 258 27 Plus