Clone BO18602 Report

Search the DGRC for BO18602

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:186
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptBtk29A-RA
Protein status:BO18602.pep: Imported from assembly
Sequenced Size:1843

Clone Sequence Records

BO18602.complete Sequence

1843 bp assembled on 2010-10-20

GenBank Submission: KX795955

> BO18602.complete
GAAGTTATCAGTCGACATGATTCCCTGCGTGAGTTTGGCCGAAACGAGCG
TCATTGGCAACATGAAGGAGCGGGTCAAGGAAATGAAGGTGTTCGGCTGC
CGACTCAACTTCTGGAACCACATTGGTCACAGCCTGACCAGTTCCAAAAC
CAAAGAAGGCAACGGCAGTTCTCCAGCCCAGAATTCAACGCGCAGCATCA
GTCCCAACAGCTCCACGACCAACAGTCAGTTTAGCTTGCAGCACAACAGC
TCGGGGAGTCTCGGCGGAGGAGTGGGCGGCGGATTGGGAGGCGGAGGCAG
CCTTGGCCTAGGCGGCGGAGGAGGAGGTGGCGGCAGTTGCACGCCCACAT
CGCTACAGCCTCAGTCCTCGCTGACAACTTTCAAGCAGTCCCCAACTCTA
TTGAACGGCAACGGAACTCTATTGGATGCCAATATGCCTGGCGGTATACC
CACTCCCGGAACACCAAATTCCAAAGCCAAGGACAACTCCCACTTTGTCA
AGCTGGTGGTGGCTCTCTATCCATTCAAGGCCATCGAAGGCGGCGATTTA
TCGCTGGAAAAGAATGCCGAATACGAAGTGATAGATGACTCACAAGAGCA
CTGGTGGAAGGTCAAAGATGCCTTGGGGAATGTCGGCTATATACCCAGCA
ACTATGTCAAGCCGAAGGCTCTTCTGGGCCTGGAGCGCTATGAATGGTAT
GTGGGCGACATGTCACGACAGAGAGCCGAATCGCTGCTGAAGCAAGGTGA
TAAGGAGGGCTGCTTTGTGGTCAGGAAGTCATCGACCAAGGGTCTCTACA
CACTATCGCTGCATACCAAAGTTCCACAGTCGCATGTGAAGCACTACCAC
ATCAAGCAAAATGCTCGCTGCGAGTATTATTTGAGTGAGAAGCACTGCTG
TGAAACAATTCCGGATCTGATTAACTACCATCGCCACAACTCTGGGGGTT
TGGCTTGCCGACTCAAATCCTCGCCCTGCGATCGCCCAGTTCCACCGACG
GCGGGATTGTCCCACGACAAATGGGAGATCCATCCGATGGAACTGATGCT
GATGGAGGAGCTTGGATCGGGACAGTTTGGTGTTGTGCGGCGCGGCAAGT
GGCGTGGGTCTATCGACACAGCGGTCAAGATGATGAAGGAAGGAACCATG
TCCGAGGACGATTTCATTGAGGAGGCCAAGGTGATGACCAAGCTGCAGCA
TCCAAATCTTGTGCAGCTATATGGCGTCTGCTCCAAGCACCGGCCCATCT
ACATTGTGACCGAGTACATGAAGCACGGATCCTTGTTGAATTACTTGCGA
CGGCATGAGAAGACCCTGATTGGTAATATGGGTCTACTCCTTGACATGTG
CATACAGGTTAGCAAGGGAATGACCTACCTGGAGCGCCATAACTACATTC
ACCGGGATCTGGCTGCCCGCAACTGTCTCGTGGGTTCCGAGAATGTCGTT
AAAGTGGCCGACTTTGGATTGGCCCGATACGTTCTCGACGATCAGTATAC
CAGCTCTGGCGGAACCAAGTTCCCCATCAAGTGGGCCCCGCCCGAAGTGC
TCAACTACACGCGCTTCTCCTCTAAGAGCGATGTGTGGGCATACGGTGTG
CTGATGTGGGAGATCTTCACTTGCGGCAAGATGCCATACGGTCGCCTAAA
GAATACCGAGGTTGTGGAGCGTGTGCAGCGCGGAATTATCCTAGAAAAAC
CAAAGTCGTGTGCCAAGGAGATTTATGATGTCATGAAGTTGTGCTGGTCA
CATGGACCCGAGGAGCGTCCCGCTTTCCGTGTGCTCATGGATCAGCTGGC
TCTTGTGGCCCAAACGCTAACCGACGCAAGCTTTCTAGACCAT

BO18602.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
Btk29A-RF 1812 CG8049-PF 1..1809 17..1825 9045 100 Plus
Btk29A-RA 1812 CG8049-PA 1..1809 17..1825 9045 100 Plus
Btk29A-RC 1812 CG8049-PC 1..1809 17..1825 9045 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
Btk29A-RF 4992 CG8049-RF 2148..3956 17..1825 9045 100 Plus
Btk29A-RA 4026 CG8049-RA 432..2240 17..1825 9045 100 Plus
Btk29A-RC 3279 CG8049-RC 435..2243 17..1825 9045 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8260906..8261681 1598..823 3880 100 Minus
2L 23513712 2L 8262475..8262682 364..157 1040 100 Minus
2L 23513712 2L 8271935..8272077 159..17 715 100 Minus
2L 23513712 2L 8260696..8260832 1731..1595 685 100 Minus
2L 23513712 2L 8261943..8262075 693..561 665 100 Minus
2L 23513712 2L 8261740..8261868 822..694 645 100 Minus
2L 23513712 2L 8262284..8262404 482..362 605 100 Minus
2L 23513712 2L 8260541..8260636 1825..1730 480 100 Minus
2L 23513712 2L 8262139..8262221 562..480 415 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:19:53 has no hits.

BO18602.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:25 Download gff for BO18602.complete
Subject Subject Range Query Range Percent Splice Strand
Btk29A-RF 2211..4019 17..1827 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:30:49 Download gff for BO18602.complete
Subject Subject Range Query Range Percent Splice Strand
Btk29A-RC 435..2243 17..1827 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:11:08 Download gff for BO18602.complete
Subject Subject Range Query Range Percent Splice Strand
Btk29A-RC 435..2243 17..1827 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:11:08 Download gff for BO18602.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8271936..8272077 17..158 100   Minus
2L 8262475..8262680 159..364 100 <- Minus
2L 8262285..8262401 365..481 100 <- Minus
2L 8262139..8262219 482..562 100 <- Minus
2L 8261943..8262073 563..693 100 <- Minus
2L 8261740..8261868 694..822 100 <- Minus
2L 8260909..8261681 823..1595 100 <- Minus
2L 8260698..8260831 1596..1729 100 <- Minus
2L 8260539..8260636 1730..1827 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:30:49 Download gff for BO18602.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8271936..8272077 17..158 100   Minus
arm_2L 8262475..8262680 159..364 100 <- Minus
arm_2L 8262285..8262401 365..481 100 <- Minus
arm_2L 8262139..8262219 482..562 100 <- Minus
arm_2L 8261943..8262073 563..693 100 <- Minus
arm_2L 8261740..8261868 694..822 100 <- Minus
arm_2L 8260909..8261681 823..1595 100 <- Minus
arm_2L 8260698..8260831 1596..1729 100 <- Minus
arm_2L 8260539..8260636 1730..1827 97 <- Minus

BO18602.pep Sequence

Translation from 16 to 1843

> BO18602.pep
MIPCVSLAETSVIGNMKERVKEMKVFGCRLNFWNHIGHSLTSSKTKEGNG
SSPAQNSTRSISPNSSTTNSQFSLQHNSSGSLGGGVGGGLGGGGSLGLGG
GGGGGGSCTPTSLQPQSSLTTFKQSPTLLNGNGTLLDANMPGGIPTPGTP
NSKAKDNSHFVKLVVALYPFKAIEGGDLSLEKNAEYEVIDDSQEHWWKVK
DALGNVGYIPSNYVKPKALLGLERYEWYVGDMSRQRAESLLKQGDKEGCF
VVRKSSTKGLYTLSLHTKVPQSHVKHYHIKQNARCEYYLSEKHCCETIPD
LINYHRHNSGGLACRLKSSPCDRPVPPTAGLSHDKWEIHPMELMLMEELG
SGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQ
LYGVCSKHRPIYIVTEYMKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSK
GMTYLERHNYIHRDLAARNCLVGSENVVKVADFGLARYVLDDQYTSSGGT
KFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCGKMPYGRLKNTEVV
ERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQLALVAQT
LTDASFLDH

BO18602.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
Btk29A-PF 603 CG8049-PF 1..603 1..603 3227 100 Plus
Btk29A-PA 603 CG8049-PA 1..603 1..603 3227 100 Plus
Btk29A-PC 603 CG8049-PC 1..603 1..603 3227 100 Plus
Btk29A-PG 565 CG8049-PG 5..565 43..603 2982 99.5 Plus
Btk29A-PE 786 CG8049-PE 215..786 26..603 2975 96.7 Plus