Clone BO18660 Report

Search the DGRC for BO18660

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:186
Well:60
Vector:pDNR-Dual
Associated Gene/Transcriptwech-RA
Protein status:BO18660.pep: Imported from assembly
Sequenced Size:2530

Clone Sequence Records

BO18660.complete Sequence

2530 bp assembled on 2010-10-20

GenBank Submission: KX797804

> BO18660.complete
GAAGTTATCAGTCGACATGATGGAACTTTTGTCAAACAATTCGGTTCCGC
AACAAATGGCCAGCAGCAATGCGCCGAGCGCCAACAATGTGGCCCACTCC
TCAACGGCCAACGGAAGTGGAGGCGGCAGTGTGAGCAGCAATGCCAGCAA
CTCCTCCGAGCGACTGCTGGCGGGCATCCTGGAGAGCTTTCCCGCCTGGG
ACCTCAACGTGGGACTACTGCCCAACGTGGGCCAGAGCTCACCACCACGC
GCAGACTTCTTTATCAATAACTTCCTGGGCGGCCTGGACACGCATGGCGA
CTTCAGCATTGGACCCATTGGCAGCGGTGCCCGCAGCAATCCGAAGATGT
CGCCAGAGTCATCTAACAACTCGAGCATCAGCTGCGGTTGGTGCGAGGTT
AGTGCTTCAATACGCTGCCTGGAGTGCAACGAGTTCATGTGCAACGACTG
CCTAAGGGAGCATCGCAACAGTCCGCTGTCCTCCAACCACTCGATCGTGT
CCTTGCCCACGCCCATTGGAGCCTCGCCCACGGGTGGCAGCTCGGTAAAT
GCACAGACTCCGCCCAGCGGCAACTTTATCTGCGACATACACAACGAGAT
GTTGCGCTACGTATGTGACTACTGCCGGAAATTGGTGTGTCAGTGCTGCA
CACTGCACGAGCACAAGGAGCACAGCTACGCGTCCATCCAAAGCTTTATG
GTGGGCTCGAAGGAGAAGCTGGAGGGCGCCATTGAGAGCAGCCAGGTGGG
CACGCGCTGCATTAAGAGCAGCATTGACAAAGCGTTGGCCTTCATCCGGC
TTATCGAGCGCAATTGCAGCGAGCTGAGCGATAATATACGCAAGGCATTC
CGTCAGTTTATCATTGCCATCGAGGACCGCGAGCGTTTCCTCCTGGACTT
TGTGGAAAAGCTCCGCCAGCGTCGTCTGGCCATCCTACACGATCAGATGG
CAGGCTTAAAGTCTGCTCTCGCCGGACTCTCCGAAACGTCCGATATGCTT
AGCAAGGTGGCGGACAATGCCTGCAACATGGACCAGATTGAAATTGCCAT
GAAGTTGACCAATGGGCAGAGGCAGATGGAGCAGTTTGCGGGCATATATA
AGGACCTGCAGCCAAAACAGGAAGTCTTTGCCTTCGCACCACCAGATTAC
AGCCTGCTACAGGATATCCGCAACCAGGGTGGCGTTATCCTGGTGGACGA
CAAGAACTTGCCCATCGTCTCTAGCAGCAACGGAATTGTGCCGAGCGTCT
CCAGTGTTAATGCCGTGGCCGCGGCCTCCGTGGGAGTTGTGGGAGGCGTT
GCTGGAGTAGTCGGAGGCGTTGGCGTGTCAAACGGCCTGGACTTGGCCTT
CGGCATGAACATGCCCAACAATCCGCTGAGTGTTGCTTCCTCAAGTGTGC
GACGTCCCCTGTTGCGAGACAATAGCTTCCGGATTCCATCGCCCATAATG
CAACCACGCGGAGGAAGTGCCTGTGGGATGTCCAGTGGGATGTCCAGCGC
TGCTCTTGATTGGGAACTCAATGGACTGCGCAGCTCGCCAGGATTACACT
TCAGTGCGCCGCGAACCACGCAGGCCATTCCGGGATGCATGGATCTGGTC
AAGGTGCGTAACTCGAATGCTCTCTCGCTATCCTTCGCCACCGAGGGCCA
CGAGGACGGACAGGTGAGCCGGCCATGGGGTCTATGCGTTGATAAAATGG
GCCACGTTCTCGTATCGGATCGCCGCAACAATCGCGTCCAGGTCTTCAAT
CCCGATGGCTCCCTAAAGTTCAAATTCGGCCGTAAAGGCGTGGGCAATGG
AGAGTTCGATCTGCCTGCTGGAATCTGTGTTGACGTTGATAATCGCATTA
TTGTGGTCGACAAGGACAATCACCGTGTGCAAATCTTTACCGCCAGCGGC
GTCTTCCTGCTCAAGTTCGGCAGCTACGGCAAGGAGTACGGCCAGTTCCA
GTATCCGTGGGATGTGGCCGTGAACTCGCGCCGCCAAATTGTGGTTACCG
ACTCGCGCAATCATCGCATCCAGCAGTTCGACTCTGAGGGTCGCTTCATC
CGCCAGATAGTGTTCGACAACCATGGGCAAACCAAAGGAATCGCCTCGCC
ACGAGGCGTTTGCTACACGCCGACGGGCAACATCATAGTGTCTGACTTTG
ACAACCACTGCCTCTACCTGATTGATCCAGACATCAACGACATTCTTTCC
GTGAAGGGACATGAGGGCTCGGGCTTCCATGAATTTAATCGACCCTCCGG
CCTGTGCTGTGACGACGAGGGCCGCATTATAGTGGCCGATTCAAAGAATC
AACGCATCCTGGTCTTCAATCAGAACCTGGACTTTATGTGGGATATCGAG
GTGCGACCCTCCATCAATCCCTTGATGCCGCCCACGCTGGACGAGAAAGA
TCGCACTTGCGATGTGGCCATAATGCCAGACGGTCGCATTGTGTTCCTCA
TTGAACTGTCGCCAGACTCCAAGGAAGGGTCAAACCCTTACAAGCGGTTT
GTGCACGTATTCGCAAGCTTTCTAGACCAT

BO18660.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
wech-RE 2499 CG42396-PE 1..2496 17..2512 12480 100 Plus
wech-RD 2499 CG42396-PD 1..2496 17..2512 12480 100 Plus
wech-RC 2499 CG42396-PC 1..2496 17..2512 12480 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
wech-RE 4316 CG42396-RE 300..2795 17..2512 12480 100 Plus
wech-RD 6021 CG42396-RD 224..2719 17..2512 12480 100 Plus
wech-RC 7593 CG42396-RC 554..3049 17..2512 12480 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7483862..7485817 2191..236 9780 100 Minus
2R 25286936 2R 7485885..7486105 237..17 1105 100 Minus
2R 25286936 2R 7483397..7483564 2512..2345 840 100 Minus
2R 25286936 2R 7483647..7483799 2344..2192 765 100 Minus
Blast to na_te.dros performed 2014-11-26 15:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
X-element 4740 X-element ROXELEMENT 4740bp 577..663 868..781 122 64.4 Minus

BO18660.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:47:47 Download gff for BO18660.complete
Subject Subject Range Query Range Percent Splice Strand
wech-RC 345..2840 17..2514 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:29:37 Download gff for BO18660.complete
Subject Subject Range Query Range Percent Splice Strand
wech-RC 554..3049 17..2514 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:07:41 Download gff for BO18660.complete
Subject Subject Range Query Range Percent Splice Strand
wech-RC 554..3049 17..2514 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:07:41 Download gff for BO18660.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7485885..7486105 17..237 100   Minus
2R 7483862..7485815 238..2191 100 <- Minus
2R 7483647..7483799 2192..2344 100 <- Minus
2R 7483395..7483564 2345..2514 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:29:37 Download gff for BO18660.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3373390..3373610 17..237 100   Minus
arm_2R 3371367..3373320 238..2191 100 <- Minus
arm_2R 3371152..3371304 2192..2344 100 <- Minus
arm_2R 3370900..3371069 2345..2514 98 <- Minus

BO18660.pep Sequence

Translation from 16 to 2530

> BO18660.pep
MMELLSNNSVPQQMASSNAPSANNVAHSSTANGSGGGSVSSNASNSSERL
LAGILESFPAWDLNVGLLPNVGQSSPPRADFFINNFLGGLDTHGDFSIGP
IGSGARSNPKMSPESSNNSSISCGWCEVSASIRCLECNEFMCNDCLREHR
NSPLSSNHSIVSLPTPIGASPTGGSSVNAQTPPSGNFICDIHNEMLRYVC
DYCRKLVCQCCTLHEHKEHSYASIQSFMVGSKEKLEGAIESSQVGTRCIK
SSIDKALAFIRLIERNCSELSDNIRKAFRQFIIAIEDRERFLLDFVEKLR
QRRLAILHDQMAGLKSALAGLSETSDMLSKVADNACNMDQIEIAMKLTNG
QRQMEQFAGIYKDLQPKQEVFAFAPPDYSLLQDIRNQGGVILVDDKNLPI
VSSSNGIVPSVSSVNAVAAASVGVVGGVAGVVGGVGVSNGLDLAFGMNMP
NNPLSVASSSVRRPLLRDNSFRIPSPIMQPRGGSACGMSSGMSSAALDWE
LNGLRSSPGLHFSAPRTTQAIPGCMDLVKVRNSNALSLSFATEGHEDGQV
SRPWGLCVDKMGHVLVSDRRNNRVQVFNPDGSLKFKFGRKGVGNGEFDLP
AGICVDVDNRIIVVDKDNHRVQIFTASGVFLLKFGSYGKEYGQFQYPWDV
AVNSRRQIVVTDSRNHRIQQFDSEGRFIRQIVFDNHGQTKGIASPRGVCY
TPTGNIIVSDFDNHCLYLIDPDINDILSVKGHEGSGFHEFNRPSGLCCDD
EGRIIVADSKNQRILVFNQNLDFMWDIEVRPSINPLMPPTLDEKDRTCDV
AIMPDGRIVFLIELSPDSKEGSNPYKRFVHVFASFLDH

BO18660.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
wech-PE 832 CG42396-PE 1..832 1..832 4354 100 Plus
wech-PD 832 CG42396-PD 1..832 1..832 4354 100 Plus
wech-PC 832 CG42396-PC 1..832 1..832 4354 100 Plus
wech-PB 832 CG42396-PB 1..832 1..832 4354 100 Plus
wech-PA 832 CG42396-PA 1..832 1..832 4354 100 Plus