Clone BO18671 Report

Search the DGRC for BO18671

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:186
Well:71
Vector:pDNR-Dual
Associated Gene/Transcriptsmi35A-RA
Protein status:BO18671.pep: Imported from assembly
Sequenced Size:2200

Clone Sequence Records

BO18671.complete Sequence

2200 bp assembled on 2010-10-20

GenBank Submission: KX796980

> BO18671.complete
GAAGTTATCAGTCGACATGTTGGATCGATGCGAAATGCCGATCCAGCTGG
ACAACGAGAAGTTGCGGCGGGATGTTCGATTGTCGGGCTCTCGACTTGAT
TTGCCACAACTCTGTAATGGATCCCGTCGGTTGGATGGCCACAACAACCA
TGTGGCTGCCAATGAGAACACGGTTACAACGACATCCCTGAATGGAAATG
GCAACGGCAATGGCAATAGCAATAGCAACAACAACAACAACATCGGATCG
CCCGTCTCCTCATCGACAACAAACAGCAGTAATGGCGGCAACGAGCGCGG
CTCCTCCACAAAGTCCAATAGCAGCAGTGGAAGTGGCAGCTCGGGAAACT
CGGCCAGCAGCACGGGAAGTGGCGAGCTCAAATGCAATACGCCCATGACG
CCATCTGAGCTGGTGAAGAAGTTCCGCAACTACCTAACCGATCTTGAGTT
CGAAGAGCTCAAGGTGTACAAGGAAGTGTGGTATTTTGGCCAGCACGCCA
GCAAGAACTACAACAAACCCGCCCCCACAGCCAATACCACAAATCTGGGC
TATGACGATGATAATGGCAACTACAAGATCATCGAACACGATCACATAGC
TTTTCGTTACGAGATTCTGGAGGTAATTGGCAAGGGCAGTTTTGGCCAGG
TCATCAGGGCGCTGGATCACAAGACCAACACACACGTGGCCATCAAGATC
ATAAGGAACAAGAAGCGCTTCCTCAACCAGGCCGTCGTCGAACTGAATAT
CCTCGATGAGCTGCGCGAAAAGGACGCGGATGGATCTCATAATGTCATAC
ACATGCTCGACTATACATATTTCCGCAAGCATTTGTGTATTACTTTTGAG
CTAATGAGCTTGAACCTGTACGAATTGATAAAGAAGAACAACTACAATGG
ATTCAGCATGAGTCTCATACGACGCTTCTGCAACTCGATTGTGAAGTGCC
TGCGTTTGCTCTATAAGGAAAACATTATTCACTGTGATCTCAAGCCGGAA
AATATCTTGCTCAAACAGCGTGGTAGCAGCTCCATTAAAGTTATCGACTT
TGGCAGCTCATGCTACGTGGATCGCAAAATCTATACGTACATCCAATCGA
GGTTCTATCGCTCCCCGGAGGTGATTCTCGGCCTGCAATACGGCACAGCC
ATCGATATGTGGAGCTTGGGCTGCATTCTGGCCGAGCTGTACACAGGATT
CCCGCTCTTCCCTGGCGAAAATGAAGTGGAGCAGTTAGCCTGCATCATGG
AGGTGCTCGGTTTGCCGCCTAAGGTGCTCATATCGGTTGCCAGGCGACGT
CGGCTGTTCTTTGATTCCCGTGATGCCCCGCGCTGCATAACTAACACCAA
GGGACGCAAACGGTCGCCAGGCAGCAAGTCGCTGGCACATATCTTGCACT
GCCAGGACCGCTATTTCATCGACTTCCTGCAGCGTTGCTTGGAGTGGGAT
CCTGCGGAGCGGATGACGCCGGACGAGGCGGCCCACCACGAGTTTCTGCA
GCCATCTGCCTCCAGTCGCCATCGCAGCTGCCGCATGTCGAGCAGTTCGT
CCAGTTCCGGACTCAACAGTGTTTCCCAGAAGTCTTCCTGCTACAGCTTT
TCGGAGATCTCGCCGGGCACCAACGGTCCCGTGGTGGCCTCGATCACCAG
CACCACGGCGGTGCACAATGCCGCGATTGCTACCACAACCAAGTCGAGAC
AGCAGCCGCCATCTCAGAGTCACGGCCATGCCCAATCGAATGGACACCTG
CCCGACATCAAGTTAAGTGCCAGCGATAAGTACAATAGCATGCAGAAGGT
GGCGGTGCGCTCGAAGATCACGTCCAGCGTCTCGGATCTGGAGTCCGTGC
AGCAGTACTCACTGCACCGCATCTACGGAGGAGTGGGTAGTGGCAGCACA
CACCATGTCTCGTCAGCGGCCACCAGGAAACATTTGCCCGGTACAGGCAG
TGGAATTGTGGGTGCCATGTCTTCCAAATACGGCAGCTCAACGTTGGCGC
ACAACCATCACAATGTGACGCACCACAATGCATCGACTGCCACCATTGCA
ACGACCACGCACCACCATCACCACCATGGTGGGCAGCAGCAACAGCAGTC
GTCGTCGGGAGCATCCACCATGGCCATGTCGCACTCACAGTCCACTGGAG
ATGTTTCCGACAGGGCCATCTTTGGGAGAGCTGCAAGCTTTCTAGACCAT

BO18671.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyrk2-RF 2241 CG4551-PF 1..2166 17..2182 10830 100 Plus
Dyrk2-RE 2169 CG4551-PE 1..2166 17..2182 10830 100 Plus
Dyrk2-RD 2169 CG4551-PD 1..2166 17..2182 10830 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyrk2-RF 4663 CG4551-RF 835..3000 17..2182 10830 100 Plus
Dyrk2-RE 4590 CG4551-RE 762..2927 17..2182 10830 100 Plus
Dyrk2-RD 4417 CG4551-RD 589..2754 17..2182 10830 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14186141..14187154 2182..1169 5070 100 Minus
2L 23513712 2L 14196927..14197299 407..35 1850 99.7 Minus
2L 23513712 2L 14195733..14196010 858..581 1390 100 Minus
2L 23513712 2L 14188863..14189036 1170..997 870 100 Minus
2L 23513712 2L 14196075..14196248 580..407 870 100 Minus
2L 23513712 2L 14189094..14189235 998..857 710 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:13:28 has no hits.

BO18671.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:06 Download gff for BO18671.complete
Subject Subject Range Query Range Percent Splice Strand
smi35A-RA 762..2922 22..2184 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:29:57 Download gff for BO18671.complete
Subject Subject Range Query Range Percent Splice Strand
smi35A-RD 594..2754 22..2184 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:58 Download gff for BO18671.complete
Subject Subject Range Query Range Percent Splice Strand
Dyrk2-RD 594..2754 22..2184 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:58 Download gff for BO18671.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14197657..14197675 22..40 100   Minus
2L 14196927..14197293 41..407 100 <- Minus
2L 14196075..14196247 408..580 100 <- Minus
2L 14195733..14196010 581..858 100 <- Minus
2L 14189095..14189233 859..997 100 <- Minus
2L 14188864..14189035 998..1169 100 <- Minus
2L 14186137..14187153 1170..2184 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:29:57 Download gff for BO18671.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14197657..14197675 22..40 100   Minus
arm_2L 14196927..14197293 41..407 100 <- Minus
arm_2L 14196075..14196247 408..580 100 <- Minus
arm_2L 14195733..14196010 581..858 100 <- Minus
arm_2L 14189095..14189233 859..997 100 <- Minus
arm_2L 14188864..14189035 998..1169 100 <- Minus
arm_2L 14186137..14187153 1170..2184 99 <- Minus

BO18671.pep Sequence

Translation from 16 to 2200

> BO18671.pep
MLDRCEMPIQLDNEKLRRDVRLSGSRLDLPQLCNGSRRLDGHNNHVAANE
NTVTTTSLNGNGNGNGNSNSNNNNNIGSPVSSSTTNSSNGGNERGSSTKS
NSSSGSGSSGNSASSTGSGELKCNTPMTPSELVKKFRNYLTDLEFEELKV
YKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEI
LEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELR
EKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSL
IRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCY
VDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPG
ENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPRCITNTKGRKRS
PGSKSLAHILHCQDRYFIDFLQRCLEWDPAERMTPDEAAHHEFLQPSASS
RHRSCRMSSSSSSSGLNSVSQKSSCYSFSEISPGTNGPVVASITSTTAVH
NAAIATTTKSRQQPPSQSHGHAQSNGHLPDIKLSASDKYNSMQKVAVRSK
ITSSVSDLESVQQYSLHRIYGGVGSGSTHHVSSAATRKHLPGTGSGIVGA
MSSKYGSSTLAHNHHNVTHHNASTATIATTTHHHHHHGGQQQQQSSSGAS
TMAMSHSQSTGDVSDRAIFGRAASFLDH

BO18671.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyrk2-PF 746 CG4551-PF 1..722 1..722 3779 100 Plus
Dyrk2-PE 722 CG4551-PE 1..722 1..722 3779 100 Plus
Dyrk2-PD 722 CG4551-PD 1..722 1..722 3779 100 Plus
Dyrk2-PA 722 CG4551-PA 1..722 1..722 3779 100 Plus
Dyrk2-PB 722 CG4551-PB 1..722 1..722 3779 100 Plus