Clone BO18672 Report

Search the DGRC for BO18672

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:186
Well:72
Vector:pDNR-Dual
Associated Gene/TranscriptCG16718-RA
Protein status:BO18672.pep: Imported from assembly
Sequenced Size:3259

Clone Sequence Records

BO18672.complete Sequence

3259 bp assembled on 2010-10-20

GenBank Submission: KX796747

> BO18672.complete
GAAGTTATCAGTCGACATGCTAAATTTAGGCAGTGCCAAAGTTGGCGCTC
TGGAGGAGGCCACCTCACCACCCCCCTTCTCCAAGGACGAGAGCTTCCAG
CTGTTGGAGCGGAGCCCCCACAATCCCGCCATATCACCCACCACCACTGT
CCCGCTGGAGCCCCCCTTCACCACCCCCCTAGCTCCCTTCGACATGGAGC
TGATGAAGCGCCACAATCTCCACGAGCGCTTAACGGGAAAGGAGAGCTTC
TGGCGCGGGCGCGACACTTCGCAGAGATTTCTGGACCAGGAGCAATTATC
AGCATCGCGTGAATCACTCGGTGCCGCCGACAAGAGAGCCCGGTTTGCAG
AAAGCAACGCCCCCACGCTCCAACTGCCAGAATCTGCCGAGCCCAGGGCC
AATGGCAAAAGACCCACTGGGAACAGGACCAACCCATCGAATCCAGCCGC
TCCCCTTCTGCCAATGACTGATCCGGATTTTGTGAAGGGCAATGTAGGCG
GCGTCTACGATGATCGCGAGTGCAGCTGCCCCAGGGAGTTCTACCAGCGG
GGCGAGATTAACACATCACTGTTCTTTGAGGACTGCGTCCGGTCCATTGA
CTTTGTCCTGGCCTACAGGATCAATGCGCACGAGCCCACGGAGCTGGAGA
ACACGGAAAAGCGTCGTGTTTTCGAGGCGAATCTCATTAGTCAGGGGCTG
GAGGTCGAGTCCAGTCAGAAGGACCAGATCTGGTTCGTTAAGATCCACGC
TCCTTTGGAGGTCCTGCGACGGTATGCGGAAATTCTTAAGCTGCGCATGC
CCATGAAGGAGATTCCAGGAATGTCCGTGGTCAATCGATCGACCAAAAGC
GTGTTTTCTAGTCTTAAACATGTTTTCCAATTCTTTCTGCGCAACATTTA
TGTGGACGAGGAAATTTTTCCAAAGCGAGCTCATCGATTCACTGCCATTT
ACAGTCGCGATAAGGAGTATCTCTTTGACATCCGACAGGATTGTTTCTTT
ACCACCGCCGTCCGTTCCCGCATCGTTGAGTTCATCCTAGATCGCCAGCG
ATTTCCTGCCAAGAATCAACATGACATGGCCTTCGGTATTGAGCGACTGA
TTGCCGAGGGTGTCTACTCTGCTGCCTATCCACTCCATGATGGTGAAATA
ACCGAGACGGGAACCATGAGAGCTCTGCTGTACAAACATTGGGCCTCTGT
GCCCAAATGGTATCGCTATCAGCCCTTGGATGACATCAAGGAATACTTCG
GTGTCAAAATTGGCTTGTACTTCGCCTGGCTGGGCTACTACACCTACATG
TTGCTGCTGGCCTCAATAGTGGGTGTCATTTGTTTCCTATATTCATGGTT
CTCCCTTAAAAACTATGTGCCTGTGAAAGATATTTGCCAGAGCGGTAATA
CAAACATAACCATGTGTCCTCTTTGTGATTGGTGCAACTTTTGGGACCTG
AAAGAGACCTGCAACTATGCCAAAGTCACGTACCTCATTGACAATCCCAG
CACCGTGTTCTTCGCCGTTTTTATGTCCTTTTGGGCCACCCTATTTCTGG
AGCTGTGGAAGCGGTACTCCGCCGAAATAACGCATCGTTGGGATCTGACG
GGATTCGATGTGCATGAAGAGCATCCGAGGCCACAATATCTGGCGCGTTT
GGAGCACATACCACCGACGAGAGTGGATTATGTGACCAATATAAAAGAGC
CAACGGTTCCCTTTTGGCGTATGAAACTTCCCGCCACCGTGTTCAGCTTT
TCAGTGGTACTGCTCCTAATTGCACTGGCCTTTGTGGCACTGCTGGCAGT
GGTTGTATACCGAATGTCCATGCTGGCCGCCCTTAAAGTGGGTGCTAGTC
CCATGACCACCTCTAGCGCTATTGTCCTAGCCACTGCATCAGCTGCCTTT
GTAAATCTGTGCCTGCTCTATATACTTAATTATATGTACAATCATTTGGC
TGAGTACCTGACAGAGCTGGAAATGTGGCGCACTCAAACTCAGTTCGATG
ACTCGCTTACCCTTAAAATTTATCTGCTGCAGTTTGTAAACTACTACGCC
TCCATTTTTTACATAGCTTTCTTCAAGGGTAAATTCGTTGGTCATCCGGG
AGAGTATAATAAGCTTTTTGACTATCGGCAGGAGGAGTGCTCATCGGGCG
GCTGTTTGACGGAGCTGTGCATCCAGTTAGCCATTATAATGGTTGGCAAG
CAGGCATTCAACACTATTCTTGAAGTGTATCTTCCCATGTTCTGGCGAAA
GGTTTTGGCCATTCAGGTGGGACTGTCGCGACTTTTCAACAACACCCCGA
ATCCAGACAAGGCGAAAGACGAACGCTGGATGCGGGATTTCAAGCTACTG
GATTGGGGTGCCCGAGGTCTGTTTCCCGAGTATTTGGAGATGGTCTTGCA
GTACGGCTTCGTAACCATCTTTGTGGCCGCTTTTCCGCTGGCGCCATTCT
TTGCCCTGCTAAATAATATCCTGGAAATGCGACTGGATGCAAAGAAACTA
TTGACCCACCACAAGCGTCCAGTATCACAGCGAGTTCGAGATATAGGAGT
GTGGTATCGTATCCTGGACTGCATAGGCAAGCTCAGCGTGATCACAAATG
GATTCATCATTGCCTTTACCTCTGACATGATACCGCGGTTGGTGTACCGG
CATTACGTAAACAAGCAAGGCACTCTGGATGGTTACCTCAACTTTACACT
ATCAGAGTTCAAAGTCATTGATTCGCCCACGTTGTATAGCTTAGCTGGCG
ATCTCTCCAACATAACAACGTGCAGATATACGGACTTTCGACTTCCACCA
TCGTCTCCAGAAAAATACACATTGAGCAGCATGTTCTACATAATTCTGGC
CTGCCGATTGGGTTTTGTAGTCGTCTTTGAAAACTTTGTTGCCCTGGTGA
TGATTTTGGTGCGTTGGTGCATTCCGGACATGAGCGTTGAACTGCGTGAC
CAAATCCGACGCGAAGTTTATGTGACCAATGAAATTATCATCGATCAAGA
GGCCCACAGGGCTCGTTTTGAGCGTGCCAAGCGCAGCAGTTCGGTGCTCC
AGACGCCAGTTGACCAGGACATGGATGCTGCCTCCATTCAAGAGCCTAAT
GCCAAGTTCATTAACATTGAAAAGCTCCTTACTGAAAATCTCACACAGAT
CGAAATGGATGCTATTATACACGGCGAAAATCCAATCACAGGAATTTCCG
GTGCCGATTGCTTAGACGAAGTGCACAAAAAACTCAGTGACGCAAGCTTT
CTAGACCAT

BO18672.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:08:01
Subject Length Description Subject Range Query Range Score Percent Strand
subdued-RA 3228 CG16718-PA 1..3225 17..3241 16125 100 Plus
subdued-RE 2781 CG16718-PE 1..2778 464..3241 13890 100 Plus
subdued-RB 2781 CG16718-PB 1..2778 464..3241 13890 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:08:03
Subject Length Description Subject Range Query Range Score Percent Strand
subdued-RA 4046 CG16718-RA 308..3532 17..3241 16125 100 Plus
subdued-RB 3531 CG16718-RB 129..3017 353..3241 14445 100 Plus
subdued-RE 3504 CG16718-RE 104..2990 355..3241 14435 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:07:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19637060..19637618 1933..1375 2795 100 Minus
3R 32079331 3R 19636277..19636741 2600..2136 2325 100 Minus
3R 32079331 3R 19639026..19639415 742..353 1950 100 Minus
3R 32079331 3R 19642078..19642415 354..17 1690 100 Minus
3R 32079331 3R 19633932..19634153 3241..3020 1110 100 Minus
3R 32079331 3R 19636799..19637006 2137..1930 1025 99.5 Minus
3R 32079331 3R 19636040..19636215 2775..2600 880 100 Minus
3R 32079331 3R 19638025..19638194 1142..973 850 100 Minus
3R 32079331 3R 19638267..19638429 972..810 815 100 Minus
3R 32079331 3R 19634212..19634350 3020..2882 695 100 Minus
3R 32079331 3R 19637850..19637971 1263..1142 610 100 Minus
3R 32079331 3R 19637675..19637792 1379..1262 575 99.2 Minus
3R 32079331 3R 19635877..19635985 2881..2773 545 100 Minus
3R 32079331 3R 19638901..19638971 811..741 355 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:07:59 has no hits.

BO18672.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:47:37 Download gff for BO18672.complete
Subject Subject Range Query Range Percent Splice Strand
CG16718-RA 330..3554 17..3243 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:29:17 Download gff for BO18672.complete
Subject Subject Range Query Range Percent Splice Strand
CG16718-RA 308..3532 17..3243 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:07:06 Download gff for BO18672.complete
Subject Subject Range Query Range Percent Splice Strand
subdued-RA 308..3532 17..3243 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:07:06 Download gff for BO18672.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19642078..19642415 17..354 100   Minus
3R 19639026..19639413 355..742 100 <- Minus
3R 19638901..19638969 743..811 100 <- Minus
3R 19638267..19638427 812..972 100 <- Minus
3R 19638026..19638194 973..1141 100 <- Minus
3R 19637851..19637971 1142..1262 100 <- Minus
3R 19637680..19637791 1263..1374 100 <- Minus
3R 19637060..19637618 1375..1933 100 <- Minus
3R 19636799..19637002 1934..2137 100 <- Minus
3R 19636278..19636739 2138..2599 100 <- Minus
3R 19636040..19636215 2600..2775 100 <- Minus
3R 19635877..19635982 2776..2881 100 <- Minus
3R 19634212..19634350 2882..3020 100 <- Minus
3R 19633930..19634152 3021..3243 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:29:17 Download gff for BO18672.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15467800..15468137 17..354 100   Minus
arm_3R 15464748..15465135 355..742 100 <- Minus
arm_3R 15464623..15464691 743..811 100 <- Minus
arm_3R 15463989..15464149 812..972 100 <- Minus
arm_3R 15463748..15463916 973..1141 100 <- Minus
arm_3R 15463573..15463693 1142..1262 100 <- Minus
arm_3R 15463402..15463513 1263..1374 100 <- Minus
arm_3R 15462782..15463340 1375..1933 100 <- Minus
arm_3R 15462521..15462724 1934..2137 100 <- Minus
arm_3R 15462000..15462461 2138..2599 100 <- Minus
arm_3R 15461762..15461937 2600..2775 100 <- Minus
arm_3R 15461599..15461704 2776..2881 100 <- Minus
arm_3R 15459934..15460072 2882..3020 100 <- Minus
arm_3R 15459652..15459874 3021..3243 99 <- Minus

BO18672.pep Sequence

Translation from 16 to 3259

> BO18672.pep
MLNLGSAKVGALEEATSPPPFSKDESFQLLERSPHNPAISPTTTVPLEPP
FTTPLAPFDMELMKRHNLHERLTGKESFWRGRDTSQRFLDQEQLSASRES
LGAADKRARFAESNAPTLQLPESAEPRANGKRPTGNRTNPSNPAAPLLPM
TDPDFVKGNVGGVYDDRECSCPREFYQRGEINTSLFFEDCVRSIDFVLAY
RINAHEPTELENTEKRRVFEANLISQGLEVESSQKDQIWFVKIHAPLEVL
RRYAEILKLRMPMKEIPGMSVVNRSTKSVFSSLKHVFQFFLRNIYVDEEI
FPKRAHRFTAIYSRDKEYLFDIRQDCFFTTAVRSRIVEFILDRQRFPAKN
QHDMAFGIERLIAEGVYSAAYPLHDGEITETGTMRALLYKHWASVPKWYR
YQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVGVICFLYSWFSLKNY
VPVKDICQSGNTNITMCPLCDWCNFWDLKETCNYAKVTYLIDNPSTVFFA
VFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEEHPRPQYLARLEHIPP
TRVDYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRM
SMLAALKVGASPMTTSSAIVLATASAAFVNLCLLYILNYMYNHLAEYLTE
LEMWRTQTQFDDSLTLKIYLLQFVNYYASIFYIAFFKGKFVGHPGEYNKL
FDYRQEECSSGGCLTELCIQLAIIMVGKQAFNTILEVYLPMFWRKVLAIQ
VGLSRLFNNTPNPDKAKDERWMRDFKLLDWGARGLFPEYLEMVLQYGFVT
IFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRDIGVWYRIL
DCIGKLSVITNGFIIAFTSDMIPRLVYRHYVNKQGTLDGYLNFTLSEFKV
IDSPTLYSLAGDLSNITTCRYTDFRLPPSSPEKYTLSSMFYIILACRLGF
VVVFENFVALVMILVRWCIPDMSVELRDQIRREVYVTNEIIIDQEAHRAR
FERAKRSSSVLQTPVDQDMDAASIQEPNAKFINIEKLLTENLTQIEMDAI
IHGENPITGISGADCLDEVHKKLSDASFLDH

BO18672.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
subdued-PA 1075 CG16718-PA 1..1075 1..1075 5654 100 Plus
subdued-PD 1099 CG16718-PD 1..1099 1..1075 5619 97.8 Plus
subdued-PE 926 CG16718-PE 1..926 150..1075 4878 100 Plus
subdued-PB 926 CG16718-PB 1..926 150..1075 4878 100 Plus
subdued-PF 950 CG16718-PF 1..950 150..1075 4843 97.5 Plus