Clone BO18688 Report

Search the DGRC for BO18688

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:186
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptCG6254-RA
Protein status:BO18688.pep: Imported from assembly
Sequenced Size:1936

Clone Sequence Records

BO18688.complete Sequence

1936 bp assembled on 2010-10-20

GenBank Submission: KX797050

> BO18688.complete
GAAGTTATCAGTCGACATGTCGGATATTCTCGCAGAAACACAAGCCGCGA
ACAGAGATTCAACAATTTGGCACCAATGGTGTCGCCTGTGCTCCAAGGAG
CATCCGACAAATCAAAATGTATTCTTCAGGGAGGCGAAACAAAACTCCTG
GGCGAGCACAATGGCCATGACCATTGGCAAGTACTTTTGGGTCGATATCA
AAAGGGAGGACGAGCTGAGCAATTTTCTGTGCTCCGAATGCTTCACATTG
ATGGACTGCCTCATCGAGTTTTCGGAGAGGGTTCGCAAAGTGCAGATCCT
TTTCAGCAAATTGCAGTTGTTACAGTCTAATAATTTGATGGATTATGAGA
AAATTCGAGAGGACTGCGGTGTGGCAACCGATGGATGGAAGCATATAATG
CTCGGAGCCGTAGACGAAAGTCTTCCCCAGAATGACGAAGTATTCATCAG
CGAGGAACAACCAATAGTCTGCCAAACAGAAACATCCAGTAAAATGAAAA
GTGAAATCCTAATGATACCAAATTTTTTGGTGGAAAAACAATGTCTTCAG
GAAAAACAAGACTTTCCTAAAGAGGAAGATGTTATTGAAGAAGAAATGCA
AATTTCTGGGGTGGAAGAGGAAATCCTAGAAGAAGATGTGGAAGAAGATC
TTGCCGAGGAAGAGGTTGAAACTGTGGAGGAAGAGATTGACACTGTGGGA
GAAGAGGTTGAAGCTGTGGAGGAAGAGTTGGAAACCCAAGACGCTACAGA
TTGCTTAGTGGAGGAAGTGGAGCACATGACAGAGGATCGCTATATCGAGG
AGTCGCAGATTATAGAAGAAAGCCAAGTTTCAGATTTCAACATGGAAACA
TATGAAATAGTACAACACAATCCGCAAAAAGAACCCGTAGAAACAAAAGA
CACCGTGGAATCTATAGAATCAAACGAGGATACCCAGGAAGATATCTCCC
GAGAGCATGTAACCGATGAGGAGGATGAAATATCAGAGGTACCAGCCATG
TATAAGTGCAATATTTGCAAAAAGCCGTATAAGAAACCCAAAGCCTACAA
GCGTCACATGGAGGAGGTTCACAACACTGTGGCCGATGATCTGCCACAGT
TGGAGTGCAATCAGTGCAAACTATGTTTTCCAACAGTCGCCCAACTGCAT
GCCCACCACCGAACCCATGTACGTGCCAAACCAAAGACAGATAACTGCTG
TCCACACTGCGAAAAGCGCTTCACCACCTCGGGAACACTGAAGCGACACA
TAGAAGGCATCCACAACCAAATAAAGCCCTATGTGTGCGACCTCTGTGGC
AAAAGCTTCAATTACATTACTGGACTGAAGGATCACAAACTTGTGCACAC
AGATGAGTGCCCCTTCGAGTGTCCCGTGTGCAAGCGAGGCTTTAAAAACA
ATGCGAGGTTAAAGATCCATTTAGATACACACAGTGCCGAAATCTACGAG
TGCACTGTATGTGGCTTGAAGTTAAAAACCCGACGCACATTCAACAAACA
CAAATTGGTGCATTCAGATACACGGCAATTTAAGTGTGAAGTCTGCGGAT
CGGCGTTCAAGCGAAGTAAGACACTGAAGGCACATCTCATCCTTCACACC
GGCATCCGGCCATATAAGTGCAATTTTTGCGGAAGAGACTTCGCCAATGG
CTCCAACTGTCGATCGCACAAACGGCAGGCACACCCCAAGGAACTGGCCG
AAGAGGAAGCTCGCGGAGTGACACGATCCACACTTCTTCCAATGCTGGAC
GAACTGACAATTGCGTCCAAGCTTTTAAAAACACCCGCAGGTCCTTGCAA
AGTAAAGGGTAGTAGGCCAAAAGCTGCGCCCAAAGATCAAGATAATGGCA
ATGAATCTCCAACGAAGGACACCGATGGTGCCATCCTCTACGAGCTGGTC
GAGGAGCTTGATTACTCCGCAAGCTTTCTAGACCAT

BO18688.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG6254-RA 1905 CG6254-PA 1..1902 17..1918 9510 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG6254-RA 2006 CG6254-RA 71..1972 17..1918 9510 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10159809..10161026 1414..197 6090 100 Minus
3R 32079331 3R 10159394..10159747 1766..1413 1770 100 Minus
3R 32079331 3R 10161082..10161261 196..17 900 100 Minus
3R 32079331 3R 10159178..10159331 1918..1765 770 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:11:35 has no hits.

BO18688.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:47:51 Download gff for BO18688.complete
Subject Subject Range Query Range Percent Splice Strand
CG6254-RA 68..1969 17..1920 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:29:43 Download gff for BO18688.complete
Subject Subject Range Query Range Percent Splice Strand
CG6254-RA 71..1972 17..1920 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:14 Download gff for BO18688.complete
Subject Subject Range Query Range Percent Splice Strand
CG6254-RA 71..1972 17..1920 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:14 Download gff for BO18688.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10161082..10161261 17..196 100   Minus
3R 10159809..10161026 197..1414 100 <- Minus
3R 10159396..10159745 1415..1764 100 <- Minus
3R 10159176..10159331 1765..1920 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:29:43 Download gff for BO18688.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5986804..5986983 17..196 100   Minus
arm_3R 5985531..5986748 197..1414 100 <- Minus
arm_3R 5985118..5985467 1415..1764 100 <- Minus
arm_3R 5984898..5985053 1765..1920 98 <- Minus

BO18688.pep Sequence

Translation from 16 to 1936

> BO18688.pep
MSDILAETQAANRDSTIWHQWCRLCSKEHPTNQNVFFREAKQNSWASTMA
MTIGKYFWVDIKREDELSNFLCSECFTLMDCLIEFSERVRKVQILFSKLQ
LLQSNNLMDYEKIREDCGVATDGWKHIMLGAVDESLPQNDEVFISEEQPI
VCQTETSSKMKSEILMIPNFLVEKQCLQEKQDFPKEEDVIEEEMQISGVE
EEILEEDVEEDLAEEEVETVEEEIDTVGEEVEAVEEELETQDATDCLVEE
VEHMTEDRYIEESQIIEESQVSDFNMETYEIVQHNPQKEPVETKDTVESI
ESNEDTQEDISREHVTDEEDEISEVPAMYKCNICKKPYKKPKAYKRHMEE
VHNTVADDLPQLECNQCKLCFPTVAQLHAHHRTHVRAKPKTDNCCPHCEK
RFTTSGTLKRHIEGIHNQIKPYVCDLCGKSFNYITGLKDHKLVHTDECPF
ECPVCKRGFKNNARLKIHLDTHSAEIYECTVCGLKLKTRRTFNKHKLVHS
DTRQFKCEVCGSAFKRSKTLKAHLILHTGIRPYKCNFCGRDFANGSNCRS
HKRQAHPKELAEEEARGVTRSTLLPMLDELTIASKLLKTPAGPCKVKGSR
PKAAPKDQDNGNESPTKDTDGAILYELVEELDYSASFLDH

BO18688.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG6254-PA 634 CG6254-PA 1..634 1..634 3394 100 Plus
CG17568-PA 513 CG17568-PA 3..509 14..592 817 33.8 Plus
CG10366-PA 578 CG10366-PA 128..539 212..618 655 34.7 Plus
wek-PB 470 CG4148-PB 270..457 392..580 524 51.3 Plus
wek-PA 470 CG4148-PA 270..457 392..580 524 51.3 Plus