Clone BO18744 Report

Search the DGRC for BO18744

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:187
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptCG2135-RA
Protein status:BO18744.pep: Imported from assembly
Sequenced Size:2092

Clone Sequence Records

BO18744.complete Sequence

2092 bp assembled on 2010-10-20

GenBank Submission: KX794788

> BO18744.complete
GAAGTTATCAGTCGACATGAAAAGTCATTGGATGCCCGTCACCTGCTTAC
TGCTTGGCAGTCTCCAGGTTCTATTGGCTTACACCGAAAACGACTTCTTG
GTGAACGCCAATCGCAAAGAACTAACTGATTCCCCTTTGTTTGAATATGA
TAATGTCAGAAAGCCCACACCAACCAAGGGATTGTTGTACCCCAGGGATT
CGGAGACCCGTGAAGTGCGGAGCTTGGATGGAATGTGGCAACTGGTTAGG
AGTGATCCATATGACCCCTTACAGGGAATTAGGGAAAAGTGGTTTATGGA
TGCCTTGAGAAAAACCGGAAGGGAGATTATTTCGATGCCAGTGCCTGCCT
CCTATAACGACATCACTACAGATAACTTACGAGATCACGTTGGAACCGTA
TGGTATGAGCGTACTTTTTTTGTGCCGCGCTCCTGGAAGACTATGCAACG
CACTTGGTTGCGATTTAGCAGCGTTCACTATTCGGCCGTGGTATGGATCA
ACGGAAGGAACGCCACAAGTCACTCCATTGGCCACCTACCCTTTGAGTCA
GAGATCTCGGGACTGCTCAGCTTTGGCGGCGATAACAGGATCACGGTGAT
GTGTGACAATCGTTTGAGCAACCGCACCATTCCTCAGGGTTCTGTTTACA
AGGTGGCTACGGATGACGGCACCGTGCCCATCCAGAGTTACACTTTCGAT
TTTTTTAACTACGCGGGAATCCACCGGAGTGTACACTTGTACACGACCCC
GCTGCTGCACATAAGCGATTTGGAGGTCACCACCCAACTAACTAAAGAAG
GATTGGGCCGCATAGACTACCGCGTGTGGTTGGATGCTAGCAAGGAGGGC
CTCCAAATCCAGCCCATCCAACTTCGGGTGCAACTAAGGGACAAAGATGG
TCATGTGGCCGCCCAGCAGATCAACAAGGCGGTCTACCATGGTACTCTGC
TGGTGCCAAATGCAACTCCCTGGTGGCCCTACCTAATGCATTCCGATCCC
GGCTACCTGTATAATCTTCAATTCGAGCTGTTTGTGGCCAGCAATGAGAA
GGAGTTGGAATCTCTGCAGGATACCTACCGCCTCCCAGTGGGCATACGTA
GCTTAAGTTGGGACAACGACAGCCTGCTGCTGAATGGAAAACCCCTCTAT
CTGCGGGGATTTGGACGGCACGAGGACTCCGATATCCGCGGGAAGGGATT
GGATAATGCGCTTCTTGCTAGAGATTTTAACCTGCTGAAGTGGACTGGAG
CCAATGCATATCGCACCTCTCACTATCCTTATTCCGAAGAGTCAATGCAG
TTTGCCGATCAGCATGGTATTATGATTATTGACGAATGCCCTGCTGTCAA
TATAGATATCTTCGAGCCGCAGCTACTGGAGAATCACATGTCCTCGCTGG
AGCAACTGATCCACCGGGACAGAAACCATCCAAGTGTTGTTGCATGGTCG
GTAGCCAACGAGCCGAGATCGAACAAGCAGGGAGCCCTTAAATACTTTGA
ATTCCTGGTAAACTATGTAAGAGAAATAGCTCACGGACGACCTCTAACCG
CGGCTATAAATGCCAACTCTTCCAGTTGCCATTTGGCGCAGTTTCTGGAC
ATCGTGGGTTTCAATCGCTATAACTCTTGGTATCAGAACTCGGGCCGTAC
TGACATGATACTTAACCTGTTGACGATAGAGGCCCAGAGTTGGCGGGATA
GGTTCGGAAAGCCTGTCATCCAATTTGAGTACGGCGGCGACACTATGGAG
GGCATGCACTCACTTCCCGCCTTTATTTGGTCGGAGGAATACCAGGTTGA
GCTCTTCTCTCGCCATTTCAAGGCTTTCGACGAGTTACGCGGAAGAGGAT
GGTTTATTGGAGAGTTTGTTTGGAACTTCGCCGATTTTCGGACCGCGCAG
ACTATTACCCGCGTGGGCGGCAACAAAAAGGGAGTCTTTACAAGGAACCG
ACAACCCAAAGAAGTGGCTCACATTCTTAGGCGGCGGTACTTCGCATTAG
CCAAGGAGTTGGATATGTTTGGGCTGCCTGAGGATCTCACTGTTTACATT
TCCAAGCATATCCATAACGAGCTTGCAAGCTTTCTAGACCAT

BO18744.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:22:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG2135-RA 2061 CG2135-PA 1..2058 17..2074 10290 100 Plus
CG15117-RF 1872 CG15117-PF 964..1241 1160..1437 385 75.9 Plus
CG15117-RE 1872 CG15117-PE 964..1241 1160..1437 385 75.9 Plus
CG15117-RF 1872 CG15117-PF 1582..1736 1778..1932 205 75.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:22:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG2135-RA 2331 CG2135-RA 91..2148 17..2074 10290 100 Plus
CG15117-RF 2707 CG15117-RF 1583..1860 1160..1437 385 75.9 Plus
CG15117-RE 2380 CG15117-RE 1256..1533 1160..1437 385 75.9 Plus
CG15117-RF 2707 CG15117-RF 2201..2355 1778..1932 205 75.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 31770592..31771758 1183..17 5835 100 Minus
3R 32079331 3R 31770218..31770534 1500..1184 1585 100 Minus
3R 32079331 3R 31769901..31770162 1762..1501 1310 100 Minus
3R 32079331 3R 31769476..31769648 2074..1902 865 100 Minus
3R 32079331 3R 31769708..31769846 1901..1763 695 100 Minus
2R 25286936 2R 19123517..19123695 1338..1160 325 78.8 Minus
Blast to na_te.dros performed on 2014-11-26 15:22:15 has no hits.

BO18744.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:38 Download gff for BO18744.complete
Subject Subject Range Query Range Percent Splice Strand
CG2135-RA 96..2153 17..2076 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:31:15 Download gff for BO18744.complete
Subject Subject Range Query Range Percent Splice Strand
CG2135-RA 91..2148 17..2076 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:11:49 Download gff for BO18744.complete
Subject Subject Range Query Range Percent Splice Strand
CG2135-RA 91..2148 17..2076 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:11:49 Download gff for BO18744.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31770592..31771758 17..1183 100   Minus
3R 31770218..31770534 1184..1500 100 <- Minus
3R 31769901..31770162 1501..1762 100 <- Minus
3R 31769708..31769846 1763..1901 100 <- Minus
3R 31769473..31769648 1902..2076 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:31:15 Download gff for BO18744.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 27596314..27597480 17..1183 100   Minus
arm_3R 27595940..27596256 1184..1500 100 <- Minus
arm_3R 27595623..27595884 1501..1762 100 <- Minus
arm_3R 27595430..27595568 1763..1901 100 <- Minus
arm_3R 27595195..27595370 1902..2076 98 <- Minus

BO18744.pep Sequence

Translation from 16 to 2092

> BO18744.pep
MKSHWMPVTCLLLGSLQVLLAYTENDFLVNANRKELTDSPLFEYDNVRKP
TPTKGLLYPRDSETREVRSLDGMWQLVRSDPYDPLQGIREKWFMDALRKT
GREIISMPVPASYNDITTDNLRDHVGTVWYERTFFVPRSWKTMQRTWLRF
SSVHYSAVVWINGRNATSHSIGHLPFESEISGLLSFGGDNRITVMCDNRL
SNRTIPQGSVYKVATDDGTVPIQSYTFDFFNYAGIHRSVHLYTTPLLHIS
DLEVTTQLTKEGLGRIDYRVWLDASKEGLQIQPIQLRVQLRDKDGHVAAQ
QINKAVYHGTLLVPNATPWWPYLMHSDPGYLYNLQFELFVASNEKELESL
QDTYRLPVGIRSLSWDNDSLLLNGKPLYLRGFGRHEDSDIRGKGLDNALL
ARDFNLLKWTGANAYRTSHYPYSEESMQFADQHGIMIIDECPAVNIDIFE
PQLLENHMSSLEQLIHRDRNHPSVVAWSVANEPRSNKQGALKYFEFLVNY
VREIAHGRPLTAAINANSSSCHLAQFLDIVGFNRYNSWYQNSGRTDMILN
LLTIEAQSWRDRFGKPVIQFEYGGDTMEGMHSLPAFIWSEEYQVELFSRH
FKAFDELRGRGWFIGEFVWNFADFRTAQTITRVGGNKKGVFTRNRQPKEV
AHILRRRYFALAKELDMFGLPEDLTVYISKHIHNELASFLDH

BO18744.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:41:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG2135-PA 686 CG2135-PA 1..686 1..686 3669 100 Plus
CG15117-PD 648 CG15117-PD 16..644 47..679 2130 61.7 Plus
CG15117-PC 656 CG15117-PC 24..652 47..679 2130 61.7 Plus
CG15117-PA 656 CG15117-PA 24..652 47..679 2130 61.7 Plus
CG15117-PB 670 CG15117-PB 38..666 47..679 2130 61.7 Plus