Clone BO18745 Report

Search the DGRC for BO18745

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:187
Well:45
Vector:pDNR-Dual
Associated Gene/TranscriptCG6201-RA
Protein status:BO18745.pep: Imported from assembly
Sequenced Size:1942

Clone Sequence Records

BO18745.complete Sequence

1942 bp assembled on 2010-10-20

GenBank Submission: KX796217

> BO18745.complete
GAAGTTATCAGTCGACATGCTGTCGCTACTCCTGGTTCTGACGACGCTTG
CCAGGATCCACGCCCACTACACGAGCGGAGATGTGGTCTATCACACAATG
CCGCACTTTTGGACGGGCGTGGGCTTCTGTCCCGCCGGACGCATTGATCA
CGAGGGGATTAGCGCCGCCCTGGGCGATCCAGCCCTTCGACTTAATCTTC
GCCTGATTGCAGCATTGCCCGTGGGCGCGGTGACCCACATTCGCATCCAC
TGGCTGCTGGAGCTGATACAATTCTGGCAGTACGACCCCAGCGGAATACC
GATTTATGATTTTTCCAAGTTCGATGACTTCATTGATTTCCTACACGAGG
AACTGCGCTTGTCCCCCGTTCTGGAGTGGATGGGCAATCTGGGTGGGGTT
TTTTCGGAAAACCCCATGCAGCAATCCTTCTACTGGGAGCACTTGGTTAA
GACCACGATTAACCACCAGATAGCACGACACGGTTCCTCCAGATTGGTCA
ACTGGCGCTATGAGACATGGAATGAACCGGACCTTCGTGGGTATAACAAG
CAAAACTTTACGGCACACACCTTTCTGGATTACGTTCAAGCTGTGCGGCG
GGGTTTGAGTAAAGCTGGAAACCTGGACAACCAGGACGGAAAGGTTCCAC
TGCCCATGTATCGCTCCCTGCGCGGCCCTGCAGGACTCTTTAAGGACTCG
AATCATCCGCTCTGCTGGAATCTATTGGAGCTATGCAGTCAAAGAGTGGT
TTACTGTCCCATCGACATACTGACTTTCCACCGAAAGGGAATCGAAGGCA
CTGCCACGGAAATCGTAAATGGTTCGCTTTCCTTGATGGCCAAAATCTAT
GAGGAGTATCCCAATCTCAAGCAGCTGCCGGTGGCCAATGATGAAGCCGA
TCCTGTGGCCGGTTGGAGCACCTCCCGGGATTTTCAGGCGGATGTGCGGT
ATGGAATCACACTGATATCTACGGTAATGCAGTTCTGGCATGCCAAGCTG
GCCGGTGGTCCACTGAGTCGCTTGGAGTCGATTAGTCATGACAACGCCTT
CCTGAGCTACCATCCCCACGAGTTCACACAGCGCACCCTTCTAGCCCACT
TCAGGATGAACGAAACCAAACCACCGCACTCGCAGCTCGTTCAGAAACCC
GTATACGCTGCTCTGGGAATGCTGGCGAAGCTGGGCACCCGGGCTGCGGA
CGTGGAAATGGTTAATATGGATACTAAACATAGCGTCCAGGTCCTGCGTA
CAGTATCCGGTGGATTAGGCGGTCCTGGTCAGTATATGGCCACAATATTT
CTGAGTCCCGAGGAGGCGGGTCCAAAGATGACAGCCTTTCATCACAAGTA
CACGCTAAACATGTCGATAGCGAATGAGTCGGCCTTCGTCACCGAGCTCC
TGGTGCCAAAGGAAACGGATCCGTACTACATATGGCAGCAAGCTGGAAGT
CCGGCTTATCCCAACGCCACTCTAAGGGAAGCGATGCGAAGAGCCCAAGC
ACCTAGACTCTACAAGACGGGACCCATCTGGCAGTACAACAGCGAGCTAG
TTATCAACTCCGCCAGCATCCCACTGCCCTGGGCGATGCTGCTCCGGGTG
TGTTCCGCATCTTGGCCCAAACTGCGACGACCGCAGCAACTTTCCATCGC
AGAGGTGACTCAGCGTGAGGTGTTCATTAGCTGGATGGAACACCCCAAAT
CCACGCAGTGCCTTCTCAGCTACGAGGTGTGGTTTAAGGAACGCGATAAT
CTGGGTCGCTCCGCCGACTGGATGCTCATCTCACAGGGCTGGCATCTGCC
ATATCCGTCGTTTCAGTATGCGCCCGGCGATAAGGGATCCGTCAATGGTT
TCTATAAAGTTCGCGGTGTGGATGTGTTTAATGAAACCAGTCCCTACTCA
CAAATAGTCGAATATCTGGAGTTGGCAAGCTTTCTAGACCAT

BO18745.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:22:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG6201-RA 1911 CG6201-PA 1..1908 17..1924 9540 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:22:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG6201-RA 2308 CG6201-RA 113..2020 17..1924 9540 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:22:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11110978..11111935 1849..892 4790 100 Minus
2L 23513712 2L 11112493..11112949 473..17 2285 100 Minus
2L 23513712 2L 11112014..11112433 891..472 2100 100 Minus
2L 23513712 2L 11110845..11110922 1924..1847 390 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:22:32 has no hits.

BO18745.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:40 Download gff for BO18745.complete
Subject Subject Range Query Range Percent Splice Strand
CG6201-RA 115..2022 17..1926 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:31:20 Download gff for BO18745.complete
Subject Subject Range Query Range Percent Splice Strand
CG6201-RA 113..2020 17..1926 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:11:55 Download gff for BO18745.complete
Subject Subject Range Query Range Percent Splice Strand
CG6201-RA 113..2020 17..1926 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:11:55 Download gff for BO18745.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11112493..11112949 17..473 100   Minus
2L 11112014..11112431 474..891 100 <- Minus
2L 11110980..11111935 892..1847 100 <- Minus
2L 11110843..11110921 1848..1926 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:31:20 Download gff for BO18745.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11112493..11112949 17..473 100   Minus
arm_2L 11112014..11112431 474..891 100 <- Minus
arm_2L 11110980..11111935 892..1847 100 <- Minus
arm_2L 11110843..11110921 1848..1926 97 <- Minus

BO18745.pep Sequence

Translation from 16 to 1942

> BO18745.pep
MLSLLLVLTTLARIHAHYTSGDVVYHTMPHFWTGVGFCPAGRIDHEGISA
ALGDPALRLNLRLIAALPVGAVTHIRIHWLLELIQFWQYDPSGIPIYDFS
KFDDFIDFLHEELRLSPVLEWMGNLGGVFSENPMQQSFYWEHLVKTTINH
QIARHGSSRLVNWRYETWNEPDLRGYNKQNFTAHTFLDYVQAVRRGLSKA
GNLDNQDGKVPLPMYRSLRGPAGLFKDSNHPLCWNLLELCSQRVVYCPID
ILTFHRKGIEGTATEIVNGSLSLMAKIYEEYPNLKQLPVANDEADPVAGW
STSRDFQADVRYGITLISTVMQFWHAKLAGGPLSRLESISHDNAFLSYHP
HEFTQRTLLAHFRMNETKPPHSQLVQKPVYAALGMLAKLGTRAADVEMVN
MDTKHSVQVLRTVSGGLGGPGQYMATIFLSPEEAGPKMTAFHHKYTLNMS
IANESAFVTELLVPKETDPYYIWQQAGSPAYPNATLREAMRRAQAPRLYK
TGPIWQYNSELVINSASIPLPWAMLLRVCSASWPKLRRPQQLSIAEVTQR
EVFISWMEHPKSTQCLLSYEVWFKERDNLGRSADWMLISQGWHLPYPSFQ
YAPGDKGSVNGFYKVRGVDVFNETSPYSQIVEYLELASFLDH

BO18745.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG6201-PA 636 CG6201-PA 1..636 1..636 3412 100 Plus