Clone BO18746 Report

Search the DGRC for BO18746

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:187
Well:46
Vector:pDNR-Dual
Associated Gene/TranscriptRs1-RA
Protein status:BO18746.pep: Imported from assembly
Sequenced Size:2380

Clone Sequence Records

BO18746.complete Sequence

2380 bp assembled on 2010-10-20

GenBank Submission: KX795430

> BO18746.complete
GAAGTTATCAGTCGACATGGGTGCAACCAAGAACCTGGACTTGATAGGCA
CCATCGAAGACGATGCCGAGGTGGAGAACTTGTCGGAGGACTCCGATGCG
GAGGTCGAGTACCAACCCACAAAACTGAGACACAAGAAGGTGACGGAGTT
TGAGAAGGGCTTCGAGTTCGTGTCCTCAGTGAAGGAGTACAACCAGGACA
CTTGGGACGACCTGATGAAGTACGTGAAGCGAAAGGCGCGCACAAAGACC
GACGACAAGATCGCCGCCCGGCTGCAAAAGCGGGGTGGCGCCGAAGCTGT
GGCCGCGGAGCAGAGCGATGGAAGTGAGATAGATCTCTCCGAGGACGAAT
TGAAGCATGACAACCTGCGGCTAAGGGAGAAGAAGGAATCCAAAAAAAAG
AAGAAGAAGGCTGGAGAGGAGGATGAAGAGGACGAGGGCGAGAAGATGCA
GTTCGCCGACACTGTAGAGGCGAACGAGCAGATCACTTCCTTCTACCAAA
TGAACCTTTCACGTCCCCTGATGCGTGCCATCGGTGTGCTGGGGTACATA
TATCCTACGCCGATCCAGGCCTCTACGATTCCTGTGGCTTTGCTAGGTCG
CGATATCTGCGGCTGTGCTGCCACGGGAACGGGCAAAACTGCTGCTTATA
TGTTGCCTACTCTAGAACGTTTGCTGTATCGTCCTCTTAACAACAAGGCC
ATCACCAGGGTACTGGTTCTTGTGCCCACTCGTGAGCTGGGCGCCCAGGT
TTACCAGGTGACAAAGCAATTGTGCCAGTTCACCACTATTGATGTGGGTC
TGGCAATTGGTGGTCTGGATGTGAAGGCTCAGGAGGCAGTACTTCGCCAG
AATCCCGACATTGTCATTGCAACGCCAGGTCGTCTAATCGATCACATTAA
AAATACGCCCAGTTTTACATTGGATTCCATTGAGGTTCTCATTCTGGACG
AGGCCGATCGTATGCTGGACGAGTACTTCGCCGAACAGATGAAGGAGATC
ATCAACTCCTGCTGTAAGACACGTCAGACCATGTTGTTCTCCGCCACAAT
GAGCGAGCAGGTCAAAGATCTGGCCGCCGTATCGCTGGACAAGCCCATCA
AGGTGTTCGTCAACAACAACCAGCAAGTGGCCTTCAATCTGCGTCAGGAA
TTTATTCGCATACGTGAGGATAAGGAGGGCGACCGTGAACCCATTCTGGC
TAGTTTGATTTGCAGGACGTTCCATGATCATTGCATGGTATTTGTGCAAA
CCAAAAAGCAGGCCCATCGACTGCACATTTTATTGGGTCTCTTGGGCGTC
CGGGCCGGCGAACTGCATGGCAATCTCACCCAGCAACAGCGTCTGGAGTC
CCTCAAGAAGTTCAAGGAGGAGCAGATTGATGTGCTTATCGCCACAGATG
TAGCTGCTCGTGGTCTCGATATTGTGGGCGTAAAAACGGTAATCAACTTT
GTGATGCCCATCACCACAGAGCACTACATCCATCGAGTGGGTCGTACGGC
TCGAGCTGGGCGTGCTGGTATATCCGTTTCCCTGGCCGGTGAAAAGGAGC
GCAAGATCGTTAAGGACATTATCAAGAATGCGGAGAGTACCATTAAGAAT
CGTATTATTCCGCCAGAGATTATTGAAAAATATCGCAACAAACTTACAAG
CTTGGAGCCAGAGATTCAAAACATTCTGGACGAAGAGCAGGCTGAACGGC
AGCTAGCCAAAACGGAGCAACAGCTCTCCAAAACGGAGCGAAAGCTGCTG
GGACAGACCAACGAGCGACGTGGTTGGTTCCAGACGAAACAGCAACGCGA
GGCGGAGAAGGATCGCTTAGCGTTGACAACCGGCGACGAGGATAAAGCAT
CTGGTGGAAAGGGTAAGGGAAAAACGGCCGGAAAGCGTAAGCGACCCGAG
TACGGAGGCGATGGCGAGGATGGACCACCGGTCAAGGATCTCGAGGCAAA
GCGCAACAAGAAGAAGAAGGAGGAGCCTCGAAAGAAGACACCGGAGCAGC
TGGCCAAAGAGCGAGCCATGAAGGAGATCGAGAAGGTGTCCCTTGTGCGC
GCCAAGATGGCCAAGCTGCGCAAACGTCCGGGCAAACTAGGAGCCGCCAC
CGAAGTTCACAGAAGCGGTGCCTCCGACGGCAAACCCAAGCGACGCGGCG
GTCAGTCGGCATTTACTAACGACTTGACCGATGTAAGTCGTGGCGGAGCT
CTGCGTCTAAGGTCCGAGGCCAATCGGCACAAAAAGATGACCAAGATCGC
TGCTAAGAAAAAGGCGAGCAGTGTGAAGCTGACAAACAAGGCGGGAAAGA
ATAAGTTCAACAAGGGCAAGAACTTCGGAGGACCTCGTCACGCCAAGAAG
GATAAAAAGAAGGCAAGCTTTCTAGACCAT

BO18746.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
Rs1-RB 2349 CG2173-PB 1..2346 17..2362 11730 100 Plus
Rs1-RA 2349 CG2173-PA 1..2346 17..2362 11730 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
Rs1-RB 2670 CG2173-RB 220..2565 17..2362 11730 100 Plus
Rs1-RA 2527 CG2173-RA 77..2422 17..2362 11730 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8165105..8165933 108..936 4145 100 Plus
2R 25286936 2R 8166114..8166848 933..1667 3675 100 Plus
2R 25286936 2R 8166909..8167454 1668..2213 2730 100 Plus
2R 25286936 2R 8167512..8167664 2210..2362 765 100 Plus
2R 25286936 2R 8164956..8165048 17..109 465 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:20:51 has no hits.

BO18746.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:27 Download gff for BO18746.complete
Subject Subject Range Query Range Percent Splice Strand
Rs1-RA 72..2406 17..2351 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:30:59 Download gff for BO18746.complete
Subject Subject Range Query Range Percent Splice Strand
Rs1-RA 77..2411 17..2351 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:11:26 Download gff for BO18746.complete
Subject Subject Range Query Range Percent Splice Strand
Rs1-RA 77..2411 17..2351 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:11:26 Download gff for BO18746.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8167514..8167653 2212..2351 100   Plus
2R 8166909..8167452 1668..2211 100 -> Plus
2R 8166116..8166848 935..1667 100 -> Plus
2R 8165107..8165931 110..934 100 -> Plus
2R 8164956..8165048 17..109 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:30:59 Download gff for BO18746.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4055019..4055158 2212..2351 100   Plus
arm_2R 4054414..4054957 1668..2211 100 -> Plus
arm_2R 4053621..4054353 935..1667 100 -> Plus
arm_2R 4052612..4053436 110..934 100 -> Plus
arm_2R 4052461..4052553 17..109 100 -> Plus

BO18746.pep Sequence

Translation from 16 to 2380

> BO18746.pep
MGATKNLDLIGTIEDDAEVENLSEDSDAEVEYQPTKLRHKKVTEFEKGFE
FVSSVKEYNQDTWDDLMKYVKRKARTKTDDKIAARLQKRGGAEAVAAEQS
DGSEIDLSEDELKHDNLRLREKKESKKKKKKAGEEDEEDEGEKMQFADTV
EANEQITSFYQMNLSRPLMRAIGVLGYIYPTPIQASTIPVALLGRDICGC
AATGTGKTAAYMLPTLERLLYRPLNNKAITRVLVLVPTRELGAQVYQVTK
QLCQFTTIDVGLAIGGLDVKAQEAVLRQNPDIVIATPGRLIDHIKNTPSF
TLDSIEVLILDEADRMLDEYFAEQMKEIINSCCKTRQTMLFSATMSEQVK
DLAAVSLDKPIKVFVNNNQQVAFNLRQEFIRIREDKEGDREPILASLICR
TFHDHCMVFVQTKKQAHRLHILLGLLGVRAGELHGNLTQQQRLESLKKFK
EEQIDVLIATDVAARGLDIVGVKTVINFVMPITTEHYIHRVGRTARAGRA
GISVSLAGEKERKIVKDIIKNAESTIKNRIIPPEIIEKYRNKLTSLEPEI
QNILDEEQAERQLAKTEQQLSKTERKLLGQTNERRGWFQTKQQREAEKDR
LALTTGDEDKASGGKGKGKTAGKRKRPEYGGDGEDGPPVKDLEAKRNKKK
KEEPRKKTPEQLAKERAMKEIEKVSLVRAKMAKLRKRPGKLGAATEVHRS
GASDGKPKRRGGQSAFTNDLTDVSRGGALRLRSEANRHKKMTKIAAKKKA
SSVKLTNKAGKNKFNKGKNFGGPRHAKKDKKKASFLDH

BO18746.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:41:12
Subject Length Description Subject Range Query Range Score Percent Strand
Rs1-PB 782 CG2173-PB 1..782 1..782 3959 100 Plus
Rs1-PA 782 CG2173-PA 1..782 1..782 3959 100 Plus
CG9253-PA 507 CG9253-PA 6..415 99..518 665 36.7 Plus
Dbp45A-PA 521 CG12759-PA 4..521 154..667 557 30.9 Plus
pit-PC 680 CG6375-PC 60..588 24..565 549 30.1 Plus