Clone BO18764 Report

Search the DGRC for BO18764

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:187
Well:64
Vector:pDNR-Dual
Associated Gene/Transcriptbowl-RB
Protein status:BO18764.pep: Imported from assembly
Sequenced Size:2266

Clone Sequence Records

BO18764.complete Sequence

2266 bp assembled on 2010-10-20

GenBank Submission: KX798798

> BO18764.complete
GAAGTTATCAGTCGACATGCCCACGGAAAGCTCATCCAGCGAGATCTCCG
GCGGAGGAGGCGGTGCGATACCCATGCTGCGACCTTCCCGGATGGATCAG
TTCATGAACTCGATGGCGGCGGCAGCGGCGGCGGTGGGTGGTGGCGGTCT
TCCTGGTGCGGCGGATAGGAACGGCGGATCCGGAGGATCGGATGGTGGCT
CCCAGAATGGCAACGGCGATTCGCGCAACTCATCGGCCAGCCGGATCTCA
GCGTATGAAACACAGCTGGCCTATCAGCAGCATTTGGCCGGACTGCATGG
TCCGCCGCCACCGCCACCACCATCGCATCATCGCGAGATCTCTGCCTTTG
TGCCGGTTCTGCCCACCGGAAAGGTGCGCCCGGGTAGTAATTCCAATTAC
GAAATCATTGCCATGATGGCGGACAAGCGAAAGGAGTTGGCCCTAAGGGA
GGCGGCTGCGGCGGCGGCAATGTTAGGACGAGGTCCTGGAGGACCCGGCG
GTCCTGGTGTGCCACCGCCTGGAGTGTTGTACGGACCAGCTGGCGTGCCA
CCTCCGCCATATCTCACCGGACCGGGTCCATCGCCCACGGGAGCCGGAAG
TTTTCCATTTCCACCAGGAGCCGCCGCCGCAGCTCTATTTCCACCTGGCC
TGGGTCCTGGAATGCATGCCGGACTCGATAGGCGCCTGCTACGTGCTCCT
GGTCGGGCATCGCGGCCTAAAAAACAGTTCATCTGCAAGTTCTGCAATCG
ACAATTCACCAAGTCGTACAATCTGCTCATCCACGAGAGGACACACACGG
ACGAGCGGCCCTATTCCTGTGATATCTGCGGCAAGGCGTTCCGGCGACAG
GATCACCTGAGGGATCACAGGTATATTCACTCCAAGGAGAAACCCTTCAA
ATGCACGGAATGCGGCAAGGGATTCTGCCAATCGAGAACCTTGGCTGTCC
ACAAGATCCTGCACATGGAGGAATCACCCCACAAGTGCCCCGTCTGCAGT
CGATCATTCAATCAGCGCTCCAACCTGAAGACCCATCTGCTCACCCACAC
GGATCACAAGCCCTACGAGTGCTCTTCATGCGGCAAAGTTTTCCGCCGTA
ACTGCGATCTACGACGCCATGCCTTGACCCATGCAGTGGGTGAGGTCAAC
TCCGGGGACTATGTGGATGTGGGCGAAGAGGATGAGGCCAGAAATTTAAG
TGGCGACGAGGAGGATTCGTTGCTGGAAGTGGACTCGCCTCGCCAGTCGC
CAGTTCACAATTTGGGCGAGTCTGGAGGATCGGGTGAGAAATCTGAGTCC
GAAAGAATGAGACTCAAGCGCAAGGCAGCCATCGATCATGAGGAAAGCGA
AGAGGAGTTCGATGACTTCGACGAGGAAGAGGAACTGCAGGATCTGCCAA
GAGTACACGATTTGCCCAGGGAAGAGGACGACGACTTTGATCCCGAGGAC
GAGGAGCAGGCAGAAGTGGCACTAGTGGCGCGTTTCCAGGCGAGTAAGGC
TGCCGCCACATCGCAATCATCGTCGTCAGTGGGCACCAAGCCGGAACGCC
AGGGAGTCACCCACTGTCATCATGAGGGTGGTGAAACCTACACAATGCGG
CCACATGGCGAGAAACATCAGGAGGAACCCGGGAACTCTGGCATTGCCAG
CCTACCCGTTCCACCTTCCTTTGTGCGATATTCTGTACCACCTGGGGCAG
CTGGACCGCCGCCTGCACCACCTGGAGCTCCTCCGCCAACCCACCAGCAC
CCAGGACATCCACACTTACTCCCACCCAACGGGGATCCCTATTTGCCCAT
TCTGCACGTTCGACGCGACTTGCACCACAAGAGCTTGAACCTTTCGAAGG
CTGGTGTTCCACCGCCACCACATACACCACCCACTATAATAACCCAGCCG
GAGTCGGGTAAACCACCCAATCAACCTTTGCATTCACCGCATGAAGCTAT
GCCCAGCTTCCTGGGATCGATACCCATGCGAAAGAGGATTCTTCCGGCAC
CGACCTTGGACTTGATGGATCCGCACCACCATCCTGGATTGGGTCAAAGG
ACCTTTGTGGATAGTCCCAGCATATATGCTTTGAATATGTCGCGACATCC
CCCCAGACAGCTTCTGGGAAAACCACCGAGTACGGAAACAAGTGGAGCCA
CCACCGAAAAGGGACCACCAGTGGCAGCACCGCCCATAGCACCACCGCCT
GCACCACCGAGAAGAACAGGGTTCAGCATTGAGGACATAATGAGGCGTGC
AAGCTTTCTAGACCAT

BO18764.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:20:23
Subject Length Description Subject Range Query Range Score Percent Strand
bowl-RH 2235 CG10021-PH 1..2232 17..2248 11160 100 Plus
bowl-RG 2235 CG10021-PG 1..2232 17..2248 11160 100 Plus
bowl-RF 2235 CG10021-PF 1..2232 17..2248 11160 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
bowl-RH 3435 CG10021-RH 364..2595 17..2248 11160 100 Plus
bowl-RG 3394 CG10021-RG 323..2554 17..2248 11160 100 Plus
bowl-RF 3507 CG10021-RF 436..2667 17..2248 11160 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3781901..3783281 868..2248 6905 100 Plus
2L 23513712 2L 3779726..3780581 17..872 4280 100 Plus
2L 23513712 2L 3605212..3605530 1031..713 695 81.2 Minus
2L 23513712 2L 3578472..3578711 1107..868 630 84.2 Minus
2L 23513712 2L 3578852..3579013 873..712 465 85.8 Minus
Blast to na_te.dros performed on 2014-11-26 15:20:22 has no hits.

BO18764.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:26 Download gff for BO18764.complete
Subject Subject Range Query Range Percent Splice Strand
bowl-RD 559..2790 17..2250 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:30:54 Download gff for BO18764.complete
Subject Subject Range Query Range Percent Splice Strand
bowl-RF 436..2667 17..2250 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:11:18 Download gff for BO18764.complete
Subject Subject Range Query Range Percent Splice Strand
bowl-RF 436..2667 17..2250 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:11:18 Download gff for BO18764.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3781904..3783281 871..2250 99   Plus
2L 3779726..3780579 17..870 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:30:54 Download gff for BO18764.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3781904..3783281 871..2250 99   Plus
arm_2L 3779726..3780579 17..870 100 -> Plus

BO18764.pep Sequence

Translation from 16 to 2266

> BO18764.pep
MPTESSSSEISGGGGGAIPMLRPSRMDQFMNSMAAAAAAVGGGGLPGAAD
RNGGSGGSDGGSQNGNGDSRNSSASRISAYETQLAYQQHLAGLHGPPPPP
PPSHHREISAFVPVLPTGKVRPGSNSNYEIIAMMADKRKELALREAAAAA
AMLGRGPGGPGGPGVPPPGVLYGPAGVPPPPYLTGPGPSPTGAGSFPFPP
GAAAAALFPPGLGPGMHAGLDRRLLRAPGRASRPKKQFICKFCNRQFTKS
YNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKEKPFKCTECG
KGFCQSRTLAVHKILHMEESPHKCPVCSRSFNQRSNLKTHLLTHTDHKPY
ECSSCGKVFRRNCDLRRHALTHAVGEVNSGDYVDVGEEDEARNLSGDEED
SLLEVDSPRQSPVHNLGESGGSGEKSESERMRLKRKAAIDHEESEEEFDD
FDEEEELQDLPRVHDLPREEDDDFDPEDEEQAEVALVARFQASKAAATSQ
SSSSVGTKPERQGVTHCHHEGGETYTMRPHGEKHQEEPGNSGIASLPVPP
SFVRYSVPPGAAGPPPAPPGAPPPTHQHPGHPHLLPPNGDPYLPILHVRR
DLHHKSLNLSKAGVPPPPHTPPTIITQPESGKPPNQPLHSPHEAMPSFLG
SIPMRKRILPAPTLDLMDPHHHPGLGQRTFVDSPSIYALNMSRHPPRQLL
GKPPSTETSGATTEKGPPVAAPPIAPPPAPPRRTGFSIEDIMRRASFLDH

BO18764.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
bowl-PH 744 CG10021-PH 1..744 1..744 4042 100 Plus
bowl-PG 744 CG10021-PG 1..744 1..744 4042 100 Plus
bowl-PF 744 CG10021-PF 1..744 1..744 4042 100 Plus
bowl-PA 744 CG10021-PA 1..744 1..744 4042 100 Plus
bowl-PD 744 CG10021-PD 1..744 1..744 4042 100 Plus