Clone BO18767 Report

Search the DGRC for BO18767

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:187
Well:67
Vector:pDNR-Dual
Associated Gene/TranscriptSuUR-RA
Protein status:BO18767.pep: Imported from assembly
Sequenced Size:2920

Clone Sequence Records

BO18767.complete Sequence

2920 bp assembled on 2010-10-20

GenBank Submission: KX799035

> BO18767.complete
GAAGTTATCAGTCGACATGTATCACTTTGTATCCGAGCAAACGCCGGAGG
TGCGGCTCACAGATGAGGCACTGGTCACGAGCCACGTGACGCAGTACCTC
AAGAGCTTTCAACTGGATGCCGTCCGCTTCGTCTACGATCGTTTGGCTAA
GCGGGAATTCTGCATCCTGAATGATGAGAGTGGCCTTGGAAAGGTCGCTA
CGGTGGCGGCACTTCTAAGTGCCCTACCACCCGCCAAAAAAACACTTGTG
GTGCTCCAGAACGATGAGCAACTGCTCACCGGTTGGCGATTCCATTTGGA
CACTCTCACTGACCTCCAGGTGTACATCATTCAGGGGGTGCAAGATACCA
CCGACTCCCCGCACAGCGTTTACCTGGCGAAATGGAGCCAACTACGGAGC
ATTGGAGATCTCAGTCGCCTCAAGTTCGACTACATTATGGTGGATAATCG
GGGGCATTCGCTGAACAACAGCTTTTGCACTTCCATGCTGCTGAAGCAAT
TCGAGGGACGGGTAAACGTTCTTATCTCCAGTGTTGACGTTACGTCCGAC
GTTAGGTTGCTCTACAATGTTCTACGGTTGGGCGGCCGACTGGAGCATCA
GTACAAAAGCTTTGCGAGCTTCGATCGAAAATTCCATCTGCCAGATCCGA
AGGAGGTATTCAGTAAGCGCATAGATCTCGAGGAATACTACAAGCAGCGG
GGATTCCTCAGCGAGTACATCAAGGACTTTCGTCTGCGTCGTTTTCGTCA
TCAATTCGACAAGTCACTGCCACTTGTCGCACCGGAGCAATACAAACACA
ATCTGAATCTCTGGTTGGCCTCAAAGAACAGCCAGAGCACAATAAGCGGC
TCAGATGTGTGCTCTACAATCGCTTCCATAGACAACAATCCGGCTCAGCA
AAATAAAACTGGGCTCTTTGAAGAAACGGATAGGTTATCCGAGCACAGCG
TGGATGATGTGGCAATGTCACCGCTGATATTCGAGTATTCCGAGTCTGAC
GATGAACCCCTAACAGTAGAACCTGATGCAGATCAAAACCCGGTATTAGT
TGTATCCAGCGATGATTGTGAGATTGTAACACCTCCAAGTACTCCGCAAA
ATCGAACGCCCTCATTAAATGAATCACCAAGGACGAAATCAAAGAAAAAA
TTTAGCAAAAAAACGTCACCGCGCAAAAAAGCTGATCTCACCGATTCCGA
AGAGGATGATGAAGCGACCGATAATATGCCGCCAAGGAAGAGAACTCGTG
CAGCCACCGTTCATCTGACACCTAAGACAAGGAGACTCAATGTTCGAATT
TTAAGGGTTTCCCTCGATACTCTGAGCACACCACCACCGTCCAGAACCAC
TACTGCGATCGTAACGCCCAAAACGGAGCCCACAGCTAGAAGAAAAAATC
TGAAAAAGCGCACGGTGAGCCCAGTGGATGTGGGTCGTCCAGCCACAAGG
GGAATGCAGCGCCTAACACGATCCGCTGAAACAAAAATAAACAGTAAGTA
CTTGAAACATCGCTCATTGGATGATGTCAAGCGTAGCTTTCCAAGGAGAG
TCAAGTTGGAGGGTAACCAAACGCCCAGAAGTAGCAAACAAATAGTGAAG
CAGGAGCCTAAGTCTAAAGTCGGGCAGGAAAAGAAACAGAAGACGGTGGA
TGTACCTGCTCAAGGAACTGCGAAACGAAAGCCTGGACGTCCGAGAAAAT
GCCAAACCAAGACTGAAGATTTGGGGAAGACAAAGACTAAGCCGAATTCA
AAGCACTTGCCACCTACTCCTCAAGTTCTCAGTGGTAGCTCGTTGTCCTC
GGAGTACATGCAATGTGCTCAGCGAATACCAGACAATTTGGATGCCATTG
AGTCGCCCGCTTTTCGTGTGCCCTTTACACCTCAACAAACTCCAATGCTT
CTAACCTTGCCGTCTACACACAATTTGCTCAACGATTCTGAGGTGGTGTC
TATTCCGCTTTACAAAGATCCAGTTGAGACAGTGGTGATCAATAGCTCGC
ACGATGAGTGTTCTCCGCAGGATCCATCGCAGAGTCGTCGCACCAAGGCT
TTGAAAAGAAAACGCAAACCCGTGACGTCCGTCAATTCAAGTTTCGGCGG
CGGATTGGGTCTACCACCGGCCAAGAGGAGTGCCAACAAATCTCCAGATC
TATTTAGCATATCCTCGGAACACTCGCAGATTCCGCTGGCGCAACCAAGA
CCCTCATCGCCCTTCGAAGGCTTTAAGATCTTTGGCTCTGAGGTGAAGCA
GTTTCAGCAGCAGCTAGCGAAAGTAAATATATCGGTGCCAAAAAAGAAGC
GAGATCGCTCGTGTTTGGATATCCTGGAGCAAATGTTCGAGCCACGACAA
CAGCAGTCGGCTAAAACTAGTCCCAAAGTCTTGCCAACCTTGCCACTGAC
CCAGAAGGATGATGCAGAGTCTACCATTACGCAGAGAAGAAGAACCCTGC
TGGAAGATGACTTCTTTGAGATAACGAACAATGGCCAATTTGGCAGTCGC
ATGCGATTGAACTCCTCTGGCGAAGTATCGCCCGTGCAACCGGATCAACA
GTCCGTCAGGCCGTCGCAGGCCAATAAAATCACCAATTATTTGATAGGTT
CTGGAATTACGCAGGAGCGAACGCAACCTTCGAATGGTAATCGCAATTCC
ATTCTTGCATCGCTGCGCAAGTCACCCAAATCTCCCAAACAGGGTGCTAA
ATCCACTCAGGCCACGAAACTAACACGCTGGTTTGGCTCCGTCTTCGGCG
GTGGAGCCTCACAGACCAGCTCCGTGGAATCGGTTAGTGCACCAAGTACG
CCGGTGAATTCATCCACAAGTGCAGCAGCTTGTCAAACGCGATCGGCGAG
AAGTGGTGGAGCATCAGGACCGACCAAAAGAAAGCGATTGGAACTGTTCA
AGGCAAGCTTTCTAGACCAT

BO18767.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
SuUR-RA 2889 CG7869-PA 1..2886 17..2902 14430 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:23:08
Subject Length Description Subject Range Query Range Score Percent Strand
SuUR-RA 3776 CG7869-RA 404..3290 16..2902 14435 100 Plus
CG45101-RA 3776 CG45101-RA 404..3290 16..2902 14435 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:23:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11066361..11068539 724..2902 10895 100 Plus
3L 28110227 3L 11065394..11065722 16..344 1645 100 Plus
3L 28110227 3L 11065828..11066029 343..544 1010 100 Plus
3L 28110227 3L 11066095..11066275 544..724 905 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:23:06 has no hits.

BO18767.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:42 Download gff for BO18767.complete
Subject Subject Range Query Range Percent Splice Strand
SuUR-RA 399..3284 17..2904 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:31:26 Download gff for BO18767.complete
Subject Subject Range Query Range Percent Splice Strand
SuUR-RA 405..3290 17..2904 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:12:05 Download gff for BO18767.complete
Subject Subject Range Query Range Percent Splice Strand
CG45101-RA 405..3290 17..2904 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:12:05 Download gff for BO18767.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11066361..11068539 724..2904 99   Plus
3L 11066096..11066274 545..723 100 -> Plus
3L 11065830..11066029 345..544 100 -> Plus
3L 11065395..11065722 17..344 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:31:26 Download gff for BO18767.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11059461..11061639 724..2904 99   Plus
arm_3L 11059196..11059374 545..723 100 -> Plus
arm_3L 11058930..11059129 345..544 100 -> Plus
arm_3L 11058495..11058822 17..344 100 -> Plus

BO18767.pep Sequence

Translation from 16 to 2920

> BO18767.pep
MYHFVSEQTPEVRLTDEALVTSHVTQYLKSFQLDAVRFVYDRLAKREFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVQDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDVTSDVRLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKS
LPLVAPEQYKHNLNLWLASKNSQSTISGSDVCSTIASIDNNPAQQNKTGL
FEETDRLSEHSVDDVAMSPLIFEYSESDDEPLTVEPDADQNPVLVVSSDD
CEIVTPPSTPQNRTPSLNESPRTKSKKKFSKKTSPRKKADLTDSEEDDEA
TDNMPPRKRTRAATVHLTPKTRRLNVRILRVSLDTLSTPPPSRTTTAIVT
PKTEPTARRKNLKKRTVSPVDVGRPATRGMQRLTRSAETKINSKYLKHRS
LDDVKRSFPRRVKLEGNQTPRSSKQIVKQEPKSKVGQEKKQKTVDVPAQG
TAKRKPGRPRKCQTKTEDLGKTKTKPNSKHLPPTPQVLSGSSLSSEYMQC
AQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVSIPLYK
DPVETVVINSSHDECSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGLGLP
PAKRSANKSPDLFSISSEHSQIPLAQPRPSSPFEGFKIFGSEVKQFQQQL
AKVNISVPKKKRDRSCLDILEQMFEPRQQQSAKTSPKVLPTLPLTQKDDA
ESTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQQSVRPS
QANKITNYLIGSGITQERTQPSNGNRNSILASLRKSPKSPKQGAKSTQAT
KLTRWFGSVFGGGASQTSSVESVSAPSTPVNSSTSAAACQTRSARSGGAS
GPTKRKRLELFKASFLDH

BO18767.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
SuUR-PA 962 CG7869-PA 1..962 1..962 4922 100 Plus
Mur2B-PB 1144 CG14796-PB 501..1081 358..935 169 19.7 Plus
Mur2B-PC 1795 CG14796-PC 501..1081 358..935 169 19.7 Plus
Mur2B-PA 1795 CG14796-PA 501..1081 358..935 169 19.7 Plus