Clone BO18803 Report

Search the DGRC for BO18803

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:188
Well:3
Vector:pDNR-Dual
Associated Gene/TranscriptLvpH-RA
Protein status:BO18803.pep: Imported from assembly
Sequenced Size:1765

Clone Sequence Records

BO18803.complete Sequence

1765 bp assembled on 2010-10-20

GenBank Submission: KX795694

> BO18803.complete
GAAGTTATCAGTCGACATGCGCCCGCAATCAGCTGCGTGTCTATTACTGG
CCATCGTTGGCTTCGTGGGAGCCACCGAGTGGTGGGAGAGTGGAAACTAC
TACCAGATCTACCCGCGCTCCTTCCGGGATTCCGACGGAGACGGCATTGG
CGACCTGAACGGGGTCACTGAAAAGCTGCAGTACCTGAAAGACATCGGCT
TCACGGGCACATGGCTGTCGCCCATATTCAAGTCGCCCATGGTCGACTTT
GGTTACGACATATCGGACTTCTACCAGATCCATCCCGAATATGGAACCAT
GGAGGACTTTGAGCGAATGATCGCCAAGGCCAAGGAGGTGGGCATTAAAA
TCATCCTGGACTTCGTACCAAACCACTCAAGTACCGAAAACGAATGGTTC
ACCAAGTCTGTGGACAGTGACCCCGTCTACAAAGACTTCTACATCTGGCA
CGATGGCAAGATCAACAACGAGACCGGTGAGCGGGAGCCGCCGAGCAACT
GGAACTCTGAGTTTCGCTACAGCGCCTGGGAGTGGAACGAGGTGCGTCAG
CAGTACTACCTCCACCAGTTCGCCATCCAGCAGGCCGACCTCAACTATCG
CAATCCGGCCGTGGTTAACGAGATGAAGAACGTTATTCGCTTCTGGCTGG
GAAAGGGAGTATCCGGATTCCGTATAGATGCAGTTCCCTACTTGTTTGAG
GTGGATCTCGATCGCTACAACCAGTATCCGGACGAGCCTCTGACCAACGA
CTCCGTGAACTGTCCCGACCCCGATGACCACTGCTACACGCAGCACATCT
ATACACAGGACATGCCGGAAACAATTGACATGGTGTACCAGTGGCGTGAG
TTGGTGGATGAGTTTCATGTGGAGAACGGCGGAGATAAGAGGCTGCTGAT
GACGGAGGCGTACACCAGCTTTGAAAACATCATGACTTACTATGGAAATG
GAGTCAGGAATGGCTCCCACATTCCCTTCAACTTTGACTTCCTTACGAGC
ATCAACAACGCCTCTAAGGCCGGAGAGTACGTAGAACATATTAAGAAGTG
GATGGACGCCATGCCCGAGGGCGTTTATGCCAATTGGGTGCTGGGCAACC
ACGACAACAAGCGAGTAGCCTCCCGATTTGGTGTCCAGCGCACCGACCTT
ATCAACATCCTGCTGCAGACTCTGCCCGGCCACGCGGTCACCTACAATGG
AGAGGAGCTGGGCATGACCGACGTCTGGATCAGCTGGGAGGACACCGTTG
ATCCGAATGCGTGCAACTCCGATCCCGACAACTACTACGCCCGATCCAGG
GATCCTGCCCGATCTCCCTACCAGTGGGATGCCTCCTCCAAAGCAGGCTT
CACCAGTGCCGATCACACCTGGTTACCAGTGGCTGATGACTACAAAACCA
ACAACGCCCTGCAGCAGCTGCGAGCTCCACGTTCCCACCTGCAGATCTTC
AAGAAACTGGTGCGCGTGCGCAAGGAGCCATCTTTTCGCCAGGGAGAACT
CAACATTCAGGCAATCGACGACGATGTGATCATCTATTCACGACAAAAGA
CCGGAAGCGATCTCTATGTAATCGTTCTCAACCTGGGTAGCACCTCCAAG
ACCTTGGACCTGACCAAGTATTACGAACTGGGCACCCAGGCGGAGGTCAT
TACCACGTCCTTGAGCTCCCAGTACATCGATGGCGATGTTATCAAATCTA
CGGAGTTCGTTGCCAATCCCTATGTGGGCACCGTCCTAGTGGCTGTCGCA
AGCTTTCTAGACCAT

BO18803.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
Mal-A1-RA 1734 CG8696-PA 1..1731 17..1747 8655 100 Plus
Mal-A8-RA 1767 CG8690-PA 117..623 100..606 495 73.2 Plus
Mal-A6-RC 1806 CG30360-PC 151..675 104..628 420 72 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:15:44
Subject Length Description Subject Range Query Range Score Percent Strand
Mal-A1-RA 1826 CG8696-RA 21..1751 17..1747 8655 100 Plus
Mal-A8-RA 1814 CG8690-RA 146..652 100..606 495 73.2 Plus
Mal-A6-RC 1892 CG30360-RC 163..687 104..628 420 72 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8450554..8451884 1347..17 6655 100 Minus
2R 25286936 2R 8449739..8449944 1747..1542 1030 100 Minus
2R 25286936 2R 8450002..8450204 1546..1344 1000 99.5 Minus
2R 25286936 2R 8472099..8472605 100..606 495 73.2 Plus
2R 25286936 2R 8465320..8465844 104..628 420 72 Plus
2R 25286936 2R 8458913..8459195 100..382 230 72.1 Plus
2R 25286936 2R 8471348..8471514 270..104 220 75.4 Minus
2R 25286936 2R 8456575..8456633 1248..1190 205 89.8 Minus
2R 25286936 2R 8471012..8471091 606..527 190 82.5 Minus
Blast to na_te.dros performed on 2014-11-26 15:15:41 has no hits.

BO18803.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:14 Download gff for BO18803.complete
Subject Subject Range Query Range Percent Splice Strand
LvpH-RA 16..1746 17..1749 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:30:20 Download gff for BO18803.complete
Subject Subject Range Query Range Percent Splice Strand
Mal-A1-RA 21..1751 17..1749 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:46 Download gff for BO18803.complete
Subject Subject Range Query Range Percent Splice Strand
Mal-A1-RA 21..1751 17..1749 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:46 Download gff for BO18803.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8450555..8451884 17..1346 100   Minus
2R 8450006..8450201 1347..1542 100 <- Minus
2R 8449737..8449943 1543..1749 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:30:20 Download gff for BO18803.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4338060..4339389 17..1346 100   Minus
arm_2R 4337511..4337706 1347..1542 100 <- Minus
arm_2R 4337242..4337448 1543..1749 99 <- Minus

BO18803.pep Sequence

Translation from 16 to 1765

> BO18803.pep
MRPQSAACLLLAIVGFVGATEWWESGNYYQIYPRSFRDSDGDGIGDLNGV
TEKLQYLKDIGFTGTWLSPIFKSPMVDFGYDISDFYQIHPEYGTMEDFER
MIAKAKEVGIKIILDFVPNHSSTENEWFTKSVDSDPVYKDFYIWHDGKIN
NETGEREPPSNWNSEFRYSAWEWNEVRQQYYLHQFAIQQADLNYRNPAVV
NEMKNVIRFWLGKGVSGFRIDAVPYLFEVDLDRYNQYPDEPLTNDSVNCP
DPDDHCYTQHIYTQDMPETIDMVYQWRELVDEFHVENGGDKRLLMTEAYT
SFENIMTYYGNGVRNGSHIPFNFDFLTSINNASKAGEYVEHIKKWMDAMP
EGVYANWVLGNHDNKRVASRFGVQRTDLINILLQTLPGHAVTYNGEELGM
TDVWISWEDTVDPNACNSDPDNYYARSRDPARSPYQWDASSKAGFTSADH
TWLPVADDYKTNNALQQLRAPRSHLQIFKKLVRVRKEPSFRQGELNIQAI
DDDVIIYSRQKTGSDLYVIVLNLGSTSKTLDLTKYYELGTQAEVITTSLS
SQYIDGDVIKSTEFVANPYVGTVLVAVASFLDH

BO18803.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:40:20
Subject Length Description Subject Range Query Range Score Percent Strand
Mal-A1-PA 577 CG8696-PA 1..577 1..577 3123 100 Plus
Mal-A5-PA 630 CG30359-PA 43..602 21..583 1599 51.9 Plus
Mal-A3-PA 574 CG8695-PA 8..574 7..577 1567 50 Plus
Mal-A4-PA 579 CG8693-PA 13..573 11..574 1562 50.1 Plus
Mal-A8-PA 588 CG8690-PA 32..567 21..556 1562 53.1 Plus