Clone BO18870 Report

Search the DGRC for BO18870

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:188
Well:70
Vector:pDNR-Dual
Associated Gene/TranscriptDif-RA
Protein status:BO18870.pep: Imported from assembly
Sequenced Size:2035

Clone Sequence Records

BO18870.complete Sequence

2035 bp assembled on 2010-10-20

GenBank Submission: KX795163

> BO18870.complete
GAAGTTATCAGTCGACATGTTTGAGGAGGCTTTCGGCGATATACAGGAAA
TTATCAATGCCAGCATGGAGTTGAATGGTGGCGCCACCGGCGGAGGCAGT
GTGGCAGGAGCTGTTGGCGGAGGCGGTGCTGCACATCACATATTATCGCA
GTCGACTTCCCTGCCGGTAATGCCGTCGCACATTCCGCTCCACCTGCAGA
ATCAGAATATGAATCAGAATCTGCCCGAGCCAAGTGCAAGAAGTGGTCCC
CACCTGCGTATCGTGGAGGAGCCGACAAGCAATATAATCCGCTTTCGCTA
CAAATGCGAGGGTCGCACCGCCGGTTCGATTCCGGGCATGAACTCCAGCT
CGGAAACGGGCAAGACCTTTCCCACCATCGAAGTGTGCAACTACGATGGA
CCCGTCATCATCGTGGTCTCCTGTGTGACGAGCGACGAGCCCTTCCGCCA
GCATCCCCACTGGCTGGTCAGCAAGGAGGAGGCGGATGCCTGCAAGTCGG
GCATCTACCAAAAGAAATTGCCGCCAGAGGAGCGGCGGCTGGTGCTCCAA
AAAGTGGGCATACAGTGCGCCAAGAAGCTGGAGATGCGCGACTCGCTGGT
GGAGAGGGAAAGGAGAAACATCGATCCCTTCAATGCCAAATTCGATCACA
AGGACCAGATCGACAAGATCAATCGGTATGAGTTGCGCCTCTGCTACCAG
GCCTTCATCACAGTGGGCAACTCAAAAGTGCCCCTGGATCCCATCGTATC
CTCACCGATTTACGGCAAGAGCAGCGAACTGACCATCACCCGGCTGTGCA
GTTGCGCGGCCACTGCGAACGGCGGCGACGAGATCATCATGCTGTGCGAG
AAGATTGCCAAGGACGACATCGAGGTGCGATTCTATGAGACGGACAAGGA
TGGACGGGAGACGTGGTTCGCCAACGCAGAGTTCCAACCCACGGACGTGT
TCAAACAGATGGCCATAGCTTTTAAGACGCCGCGCTACAGGAACACCGAG
ATCACACAAAGTGTTAATGTGGAGCTGAAACTAGTGAGACCCTCGGATGG
AGCGACGAGTGCCCCACTGCCGTTCGAGTACTACCCGAATCCAGAACTCC
TAACCAAACACAATCGCCGTGTTGCCCAAAAAACAGTTGAAAGCCTAAAG
CGCAGTCTCATGAGCACCAATTTACATCCATCCAAGCAGGTTAAAACCTC
CAGCCAGTATACGATATTTTCCAAGCCACAAATTGCGACCACAACACCGC
AGACACAGGTGTCGCCTGGTATGCCTTTGATGTTTCCCGGCGGAAGTCCC
AATTTTGTGCAGGATATCAAGATGGAGAATGGATTCATGGATGTGGATAG
CCAGAGTAGCCAGTGTCCATCAGTGGAACGCAATTTCGCTTCGCCTCGAT
CCAACTGCAGTACAGTGGATAGTATTCCGCCGATGCAAATGGGGCAAAAT
CAAACTCATCTTTATTTGCCAGATGCCACAAACTTCACATTTAATGGGAA
TTTCGCATCGCCTTCGTCCAATTGCAGTACAGTGGATAGCATTCCGCCGT
TTCAAATCGGACAGAGGAATAACCATATGTATCTGCCGGAGAATTCAAAC
TTTCCGGTAAACGGCTGTAGTCCTACCCATTTCAGTGGTGGCTCTATGAC
ACCAATCAATAATAACAACAATGTACTAATTAATAACAATAACAATGACT
TTTTAAGTCAGAAAATGAGTGCCATAAGCATACCGCCACAAGGAAATTTT
GGCATTAAACAGGTATATCAACAGACTCAGCAGTTCCTGCCGCAATTGCA
GCCAGAGTCCATTCCATATCTGGCCCAATCCCATCCAGAACAGTCGCAGT
ACCAACAGCAACAGCAGCCACAGGAGCAGCAACCTCCAGCAGATGAACCC
ACCCAATCGTTTAGTGATCTAATTTCCAGCAGCATAGGCATGGCGCCCAT
TGACACCAGCGAACTTATCCAGGACATTGAGGCAGAACTCAATAGCTTAG
GAATTCAGCCATTCAAAGCAAGCTTTCTAGACCAT

BO18870.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dif-RD 2004 CG6794-PD 1..2001 17..2017 9990 100 Plus
Dif-RB 2004 CG6794-PB 1..2001 17..2017 9990 100 Plus
Dif-RA 2004 CG6794-PA 1..2001 17..2017 9990 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dif-RD 2595 CG6794-RD 325..2325 17..2017 9990 100 Plus
Dif-RB 2483 CG6794-RB 213..2213 17..2017 9990 100 Plus
Dif-RA 2835 CG6794-RA 565..2565 17..2017 9990 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17413518..17414332 2017..1203 4060 99.9 Minus
2L 23513712 2L 17418488..17419078 635..45 2955 100 Minus
2L 23513712 2L 17417989..17418375 1021..635 1935 100 Minus
2L 23513712 2L 17415280..17415390 1203..1093 555 100 Minus
2L 23513712 2L 17417571..17417646 1094..1019 380 100 Minus
Blast to na_te.dros performed 2014-11-26 15:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2286..2388 1783..1883 159 63.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6774..6920 1758..1902 154 57.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2365..2437 1839..1909 144 68.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2421 1769..1883 143 58.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6752..6817 1826..1892 143 70.1 Plus
roo 9092 roo DM_ROO 9092bp 1073..1132 1832..1892 140 72.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6731..6809 1826..1902 138 65.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6709..6838 1756..1892 136 59.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..6788 1839..1902 127 68.2 Plus
roo 9092 roo DM_ROO 9092bp 1095..1170 1842..1917 127 66.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6771..6815 1839..1883 126 75.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2728..2800 1819..1891 121 68 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2325..2372 1847..1892 118 75 Plus
roo 9092 roo DM_ROO 9092bp 1113..1160 1839..1886 114 70.8 Plus

BO18870.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:15 Download gff for BO18870.complete
Subject Subject Range Query Range Percent Splice Strand
Dif-RB 215..2209 23..2019 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:30:24 Download gff for BO18870.complete
Subject Subject Range Query Range Percent Splice Strand
Dif-RA 571..2565 23..2019 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:54 Download gff for BO18870.complete
Subject Subject Range Query Range Percent Splice Strand
Dif-RA 571..2565 23..2019 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:54 Download gff for BO18870.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17420066..17420087 23..44 100   Minus
2L 17418488..17419078 45..635 100 <- Minus
2L 17417992..17418374 636..1018 100 <- Minus
2L 17417571..17417646 1019..1094 100 <- Minus
2L 17415281..17415388 1095..1202 100 <- Minus
2L 17413515..17414332 1203..2019 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:30:24 Download gff for BO18870.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17420066..17420087 23..44 100   Minus
arm_2L 17418488..17419078 45..635 100 <- Minus
arm_2L 17417992..17418374 636..1018 100 <- Minus
arm_2L 17417571..17417646 1019..1094 100 <- Minus
arm_2L 17415281..17415388 1095..1202 100 <- Minus
arm_2L 17413515..17414332 1203..2019 99 <- Minus

BO18870.pep Sequence

Translation from 16 to 2035

> BO18870.pep
MFEEAFGDIQEIINASMELNGGATGGGSVAGAVGGGGAAHHILSQSTSLP
VMPSHIPLHLQNQNMNQNLPEPSARSGPHLRIVEEPTSNIIRFRYKCEGR
TAGSIPGMNSSSETGKTFPTIEVCNYDGPVIIVVSCVTSDEPFRQHPHWL
VSKEEADACKSGIYQKKLPPEERRLVLQKVGIQCAKKLEMRDSLVERERR
NIDPFNAKFDHKDQIDKINRYELRLCYQAFITVGNSKVPLDPIVSSPIYG
KSSELTITRLCSCAATANGGDEIIMLCEKIAKDDIEVRFYETDKDGRETW
FANAEFQPTDVFKQMAIAFKTPRYRNTEITQSVNVELKLVRPSDGATSAP
LPFEYYPNPELLTKHNRRVAQKTVESLKRSLMSTNLHPSKQVKTSSQYTI
FSKPQIATTTPQTQVSPGMPLMFPGGSPNFVQDIKMENGFMDVDSQSSQC
PSVERNFASPRSNCSTVDSIPPMQMGQNQTHLYLPDATNFTFNGNFASPS
SNCSTVDSIPPFQIGQRNNHMYLPENSNFPVNGCSPTHFSGGSMTPINNN
NNVLINNNNNDFLSQKMSAISIPPQGNFGIKQVYQQTQQFLPQLQPESIP
YLAQSHPEQSQYQQQQQPQEQQPPADEPTQSFSDLISSSIGMAPIDTSEL
IQDIEAELNSLGIQPFKASFLDH

BO18870.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:40:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dif-PD 667 CG6794-PD 1..667 1..667 3510 100 Plus
Dif-PB 667 CG6794-PB 1..667 1..667 3510 100 Plus
Dif-PA 667 CG6794-PA 1..667 1..667 3510 100 Plus
Dif-PC 987 CG6794-PC 1..363 1..363 1893 99.2 Plus
dl-PB 677 CG6667-PB 7..341 20..373 725 45.4 Plus