Clone BO18884 Report

Search the DGRC for BO18884

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:188
Well:84
Vector:pDNR-Dual
Associated Gene/Transcriptfu2-RA
Protein status:BO18884.pep: Imported from assembly
Sequenced Size:1708

Clone Sequence Records

BO18884.complete Sequence

1708 bp assembled on 2010-10-20

GenBank Submission: KX799856

> BO18884.complete
GAAGTTATCAGTCGACATGCATACATCGGATATCAGCATGACCCAGGATC
AGGATGTGAGCACTTGTCGCCTGTGCCACCATAATACGGATCCCAACTCG
CTAAACATTTTCGATGACACCGTGCAGTTTTGCAAGGATGTGTCCATTGC
AGAGGTTTCCAAGAGTCTCTGGAGCGTTCAGTACGATCGCAACGAATGTT
TGTCGGAGCTCATTTGCTCAAGGTGTCTGGAGATCCTCGAAGAGGCATTC
GAGCTGCGAAAAGGAATGCAGGAGCGGGAACAGTCCCTGCAGGAGCAGCT
GAAGGAGATGATTAAAGATCATCCGAAGCACCGTCCAGGCCTGAATGGCA
ACCCCGGAGTATTCGTACCCGAGGAGGGCTGCATTATTGTGGAAGTTGAT
CCAGAGAATCTGGCAGAGAGCAGTGAAGAGGAATTCGCACTCGGCTCCGA
TGGGGAGTACGAAAACTATGACGACGATGATGAGGAGGAGGAGGAAGACT
ACGATGAGGAGGACGAGGAAGATGGCCAGAACGGCGAAGACGTCGACATG
CCACTGGGCATGGATGCGGCCCAGATGGCGGCTCAACAGTCCGTTGCCAA
CAACGCCAACACCACGGAGGCACGGCCAAAGCGAGCGTTCCTCTGTCAAT
ACTGTGATCTTGGGTTCACTCTGCCCGCCGAGTGTCAAGAGCACGAGCTG
GCTGCACACGATCCCAACGCACCGTACTGCTGCAACTTTTGCAACATCAA
GCTGGTTACCCGGCCTGCTTTGATTTCGCACATAAAGACACTGCATGATC
CGGACCGTCCGTATGTGTGTGCTCACTGTCGGAAGGGTTTTGTGCGCCGC
TCCGATCTTAAAAAGCACACAATCGTGCACACTGGCGTGAGGCCCTTCAC
ATGCAACGTTTGCTCCAAGAGTTTCTCGCGGAATACAAATCTGACCAAGC
ACATGCGCATTCATAGCGGTGTCAAGCCCTTTGTTTGCCAGCAGTGTCCG
CGATCCTTCCAGACGGCTGTGGAAATGATGCGCCACACACGTTCGCACGG
AGAGGTAAAGGCTTTCCAATGTGGACGCTGTCCCTACTCGTTTTCGCGCA
GGGATAAGCTAATAGCCCACCAGCAAGTCCATACCAGGCGGGACATGGAG
CAGCAGCAGCAAATGGGTCTAATTCCCCCGATGGAGGGTGATCTGCAGCA
GCAGGCGTTGCAGGCTAAACAAAAGGCTGCCGCACAAACCAAAAACTCAC
GCTATTACCACTGTGATGTCTGCGATCGAACTTTCCAACGGGAGAGGGAC
CTGCAACGCCATCAAGCTCTTCACATGGACTCGCTGTTCGCCTGCAAGAC
ATGTAATCAAGGTTTCAACCGACGCGAGCAACTGCAGCGCCATGAGCTAG
AGGCTCATGGTCCCAGCTTTACGTGCGGAATCTGTTGCATTAGCTTCCTG
CATCAAATTGAGCTGGAGAATCACCTCAAAGTCCATCAGTTGCAGCACAA
GATGGCCCAGCGGGCTCAAGAGGCTGCTATTTTACCCCTAAAAATGGCCG
AAAAGGCTCCAGTGGCTATGACGGCTCCGCTAGTTCAGGATCCCCAGCTA
GTGCGTCCCTCGGCAGCGGAACTGTCGTTCTACAGCAACATGATTCCCAC
AATGAATCTGGGCTTCTACAGCGAGACTCGTCCCGAGGAAGCAAGCTTTC
TAGACCAT

BO18884.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
fu2-RB 1677 CG9233-PB 1..1674 17..1690 8355 99.9 Plus
fu2-RA 1677 CG9233-PA 1..1674 17..1690 8355 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
fu2-RB 2149 CG9233-RB 123..1796 17..1690 8355 99.9 Plus
fu2-RA 1984 CG9233-RA 123..1796 17..1690 8355 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8464830..8466341 179..1690 7545 99.9 Plus
2L 23513712 2L 8464610..8464774 17..181 825 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:17:39 has no hits.

BO18884.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:18 Download gff for BO18884.complete
Subject Subject Range Query Range Percent Splice Strand
fu2-RA 121..1794 17..1692 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:30:33 Download gff for BO18884.complete
Subject Subject Range Query Range Percent Splice Strand
fu2-RA 123..1796 17..1692 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:10:27 Download gff for BO18884.complete
Subject Subject Range Query Range Percent Splice Strand
fu2-RA 123..1796 17..1692 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:10:27 Download gff for BO18884.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8464833..8466341 182..1692 99   Plus
2L 8464610..8464774 17..181 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:30:33 Download gff for BO18884.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8464833..8466341 182..1692 99   Plus
arm_2L 8464610..8464774 17..181 100 -> Plus

BO18884.pep Sequence

Translation from 16 to 1708

> BO18884.pep
MHTSDISMTQDQDVSTCRLCHHNTDPNSLNIFDDTVQFCKDVSIAEVSKS
LWSVQYDRNECLSELICSRCLEILEEAFELRKGMQEREQSLQEQLKEMIK
DHPKHRPGLNGNPGVFVPEEGCIIVEVDPENLAESSEEEFALGSDGEYEN
YDDDDEEEEEDYDEEDEEDGQNGEDVDMPLGMDAAQMAAQQSVANNANTT
EARPKRAFLCQYCDLGFTLPAECQEHELAAHDPNAPYCCNFCNIKLVTRP
ALISHIKTLHDPDRPYVCAHCRKGFVRRSDLKKHTIVHTGVRPFTCNVCS
KSFSRNTNLTKHMRIHSGVKPFVCQQCPRSFQTAVEMMRHTRSHGEVKAF
QCGRCPYSFSRRDKLIAHQQVHTRRDMEQQQQMGLIPPMEGDLQQQALQA
KQKAAAQTKNSRYYHCDVCDRTFQRERDLQRHQALHMDSLFACKTCNQGF
NRREQLQRHELEAHGPSFTCGICCISFLHQIELENHLKVHQLQHKMAQRA
QEAAILPLKMAEKAPVAMTAPLVQDPQLVRPSAAELSFYSNMIPTMNLGF
YSETRPEEASFLDH

BO18884.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
fu2-PB 558 CG9233-PB 1..558 1..558 3011 100 Plus
fu2-PA 558 CG9233-PA 1..558 1..558 3011 100 Plus
Meics-PB 571 CG8474-PB 171..570 135..493 392 26 Plus
Meics-PA 583 CG8474-PA 183..582 135..493 392 26 Plus
CG5245-PA 501 CG5245-PA 18..354 152..490 373 29.9 Plus