Clone BO18892 Report

Search the DGRC for BO18892

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:188
Well:92
Vector:pDNR-Dual
Associated Gene/Transcriptaz2-RA
Protein status:BO18892.pep: Imported from assembly
Sequenced Size:1813

Clone Sequence Records

BO18892.complete Sequence

1813 bp assembled on 2010-10-20

GenBank Submission: KX795099

> BO18892.complete
GAAGTTATCAGTCGACATGGTGGTTTGCGGGAACATTTTGGCCAGGAACA
ACTTCGAGCACTTTGTTCTGGCGTGTGCTCACCAAAATGACTGCTACGTG
GAGATGGAGTTCAAGCGGTGGCGAGAGTTCATCGTGCACGTCAAGGAGCA
CCTGGAAGCAAATCCAAGCATGCAGCAAGAGCTCACTACTTCCGAAGTCA
TTTCGTCAGCCAAATGCGAGGAGGAGGTCTCGCCAGCCAAGGTGTTCATA
GTGGAGGAGCCTCCGGAAAATTGCCTGGCTGAAGACATGTTCGTTGACGT
GCCACCTTCATCAGAGAACGACGAGAGCACCAGCCCGGTGGAGGAGGAGG
AGGAAGAAGACGACGAGGTGGACTCCTCCTCGATGACAGTTGACTGCGAA
TTGGGCACCAGAAACTCCACACACTTTGCTCCTTTAACCAAATTCAATCC
TACGTTTTACCGACGCAGTCCTCGGATCACACAGTTCATTGAACTGTATA
AGCAGCAGACATGCCTCTGGGATCCAGCGGATGAGTCGTACAGGGACAAG
GAGAAACGCGCAAATGCCTATGAGGAGTTGCTGGAGCAATTAAAGGCGAC
CGTCAATCTTCACCTAACGGCCTATAAGCTGAAGAAGTGCATCACCAGCC
TACACGCGCAGTATGCGTCGATCTCGCGGCAGAAGAAAACTCAGAAACTA
ACCAAGGTTCCACTGTACTACCATGGAAAGTACAGCTTTCTGGCAGAGCG
CGGTAGTCTGGAGGATGCGGACAGCGATGATGTCGACGGCGATGGCAAAA
TAAAGCTGGTGTTCACAGAGGAGAATCAACTGACCACACAGTTCATTGAT
TTGTACTCCAAGTTTCCCCAACTGTACGATCCCGCGCACAAGCACTTCTG
CAATCTAAACGTACGAAAGTCATCGCTCATAGAGATCACTGACCTGCTGA
CTTCGGAGTTTTCGTTGGGCCTGGTCACCCACTACGATGTCTACGACAGT
ATTCAGAGCATGCGCCAATGGTATTCGCGACGGATCAAAACCCTCACAGA
CGTCCAATGTGTGGGTCTCTCGCTGGCCGAGAAGCAGTACATCGAGCGCT
GCAATAGCTTTATGCCCACTAAATCATTCCGACAGAAGCTTAAATGTGAA
GTCTGCGAGCACTCCTTTAGCACAGATCACGCCCTGCAAGCACATCAGTT
CCGGGATCATAAGATGGGCGATGGAGGCTGGTTTCGCTGCACGCTTTGCG
AGCTGAACTTCGACCGAAAGTGTCACCTGCAGCAGCACAGCCAGCGTGTG
CACATGGACAAGAGCTTTGTCTGCGAGATCTGCAGCAGGAGCTTTGCCTT
TGGAAATCAACTGGCTATCCACAAACGCACCCATGACGAGAAGCACGTCG
CCAAGCCATTTGTCTGCGAGTTCTGCGGCAAGTGTTTTAAGCAAAAAATC
CAAATGACAACGCACGTAACTGCGGTTCACACCAAGATCCGAGCCTTCAA
GTGCGACATGTGCCCCAAGGACTTCCTGACCAAGCGCGACCTCAAGGACC
ACGTAAAGGCGCACCTGAACATCCGCGACAAGGTCTGCGAGGTCTGTCAG
AAGGCCTTCACCAATGCCAACGCCTTAGTCAAGCATCGCCACATCCACAA
GGAGAAGACCCTGCAATGTTCGCTCTGCACGACGCGCTTCTCGGAGCGAG
TTAGTCTTGGCGTCCACATGCGACGCACCCACAAGATCCTCAAGAGCTCT
CTGTCGTCAAGCGACGCACTCTTTACAAAGACATTCCCTCAGCCTGCAAG
CTTTCTAGACCAT

BO18892.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
az2-RA 1782 CG1605-PA 1..1779 17..1795 8895 100 Plus
CG1602-RA 1734 CG1602-PA 1392..1530 1450..1588 185 75.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
az2-RA 2006 CG1605-RA 54..1833 16..1795 8900 100 Plus
CG1602-RA 1901 CG1602-RA 1468..1606 1450..1588 185 75.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:15:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7510795..7511786 1795..804 4960 100 Minus
2R 25286936 2R 7512270..7512696 442..16 2135 100 Minus
2R 25286936 2R 7511841..7512203 805..443 1815 100 Minus
2R 25286936 2R 7517218..7517356 1588..1450 185 75.5 Minus
Blast to na_te.dros performed on 2014-11-26 15:15:53 has no hits.

BO18892.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:15 Download gff for BO18892.complete
Subject Subject Range Query Range Percent Splice Strand
az2-RA 30..1808 17..1797 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:30:22 Download gff for BO18892.complete
Subject Subject Range Query Range Percent Splice Strand
az2-RA 55..1833 17..1797 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:48 Download gff for BO18892.complete
Subject Subject Range Query Range Percent Splice Strand
az2-RA 55..1833 17..1797 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:48 Download gff for BO18892.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7512270..7512695 17..442 100   Minus
2R 7511841..7512203 443..805 100 <- Minus
2R 7510792..7511784 806..1797 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:30:22 Download gff for BO18892.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3399775..3400200 17..442 100   Minus
arm_2R 3399346..3399708 443..805 100 <- Minus
arm_2R 3398297..3399289 806..1797 99 <- Minus

BO18892.pep Sequence

Translation from 16 to 1813

> BO18892.pep
MVVCGNILARNNFEHFVLACAHQNDCYVEMEFKRWREFIVHVKEHLEANP
SMQQELTTSEVISSAKCEEEVSPAKVFIVEEPPENCLAEDMFVDVPPSSE
NDESTSPVEEEEEEDDEVDSSSMTVDCELGTRNSTHFAPLTKFNPTFYRR
SPRITQFIELYKQQTCLWDPADESYRDKEKRANAYEELLEQLKATVNLHL
TAYKLKKCITSLHAQYASISRQKKTQKLTKVPLYYHGKYSFLAERGSLED
ADSDDVDGDGKIKLVFTEENQLTTQFIDLYSKFPQLYDPAHKHFCNLNVR
KSSLIEITDLLTSEFSLGLVTHYDVYDSIQSMRQWYSRRIKTLTDVQCVG
LSLAEKQYIERCNSFMPTKSFRQKLKCEVCEHSFSTDHALQAHQFRDHKM
GDGGWFRCTLCELNFDRKCHLQQHSQRVHMDKSFVCEICSRSFAFGNQLA
IHKRTHDEKHVAKPFVCEFCGKCFKQKIQMTTHVTAVHTKIRAFKCDMCP
KDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNANALVKHRHIHKEKTLQ
CSLCTTRFSERVSLGVHMRRTHKILKSSLSSSDALFTKTFPQPASFLDH

BO18892.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:40:22
Subject Length Description Subject Range Query Range Score Percent Strand
az2-PA 593 CG1605-PA 1..593 1..593 3175 100 Plus
CG1602-PA 577 CG1602-PA 1..565 1..578 1038 38.6 Plus
CG1603-PB 586 CG1603-PB 1..586 1..547 732 30.1 Plus
CG1603-PA 586 CG1603-PA 1..586 1..547 732 30.1 Plus
rgr-PA 856 CG8643-PA 434..847 158..572 360 25.3 Plus