Clone BO18916 Report

Search the DGRC for BO18916

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:189
Well:16
Vector:pDNR-Dual
Associated Gene/TranscriptUev1A-RB
Protein status:BO18916.pep: full length peptide match
Sequenced Size:343

Clone Sequence Records

BO18916.complete Sequence

343 bp assembled on 2010-10-06

GenBank Submission: KX798675

> BO18916.complete
GAAGTTATCAGTCGACATGACGCTCACCTACTGGATCGGCATGATCATCG
GTCCGCCTAGAACACCATTCGAGAATCGAATGTATTCACTAAAGATCGAG
TGCGGCGAACGCTATCCGGATGAGCCACCAACGCTCCGGTTTATAACTAA
AGTAAACATTAACTGCATTAATCAGAACAATGGCGTGGTTGATCATAGAT
CAGTTCAGATGTTGGCCAGATGGAGTCGCGAGTACAATATAAAAACGATG
CTGCAGGAAATCCGTAGGATTATGACCATGAAAGAGAACCTGAAGCTGGC
ACAGCCGCCAGAAGGTAGCTGTTTTGCAAGCTTTCTAGACCAT

BO18916.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Uev1A-RC 438 CG10640-PC 123..435 13..325 1565 100 Plus
Uev1A-RA 438 CG10640-PA 123..435 13..325 1565 100 Plus
Uev1A-RB 312 CG10640-PB 1..309 17..325 1545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Uev1A-RC 1189 CG10640-RC 149..461 13..325 1565 100 Plus
Uev1A-RB 1609 CG10640-RB 303..615 13..325 1565 100 Plus
Uev1A-RA 1196 CG10640-RA 192..504 13..325 1565 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5363878..5364016 325..187 695 100 Minus
3L 28110227 3L 5364082..5364209 189..62 640 100 Minus
3L 28110227 3L 5364943..5364991 61..13 245 100 Minus
Blast to na_te.dros performed on 2014-11-28 05:33:27 has no hits.

BO18916.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-06 18:32:05 Download gff for BO18916.complete
Subject Subject Range Query Range Percent Splice Strand
Uev1A-RA 196..504 17..327 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:26:47 Download gff for BO18916.complete
Subject Subject Range Query Range Percent Splice Strand
Uev1A-RA 196..504 17..327 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:13:42 Download gff for BO18916.complete
Subject Subject Range Query Range Percent Splice Strand
Uev1A-RA 196..504 17..327 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:13:42 Download gff for BO18916.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5364943..5364987 17..61 100   Minus
3L 5364084..5364209 62..187 100 <- Minus
3L 5363876..5364015 188..327 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:26:47 Download gff for BO18916.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5358043..5358087 17..61 100   Minus
arm_3L 5357184..5357309 62..187 100 <- Minus
arm_3L 5356976..5357115 188..327 98 <- Minus

BO18916.pep Sequence

Translation from 16 to 343

> BO18916.pep
MTLTYWIGMIIGPPRTPFENRMYSLKIECGERYPDEPPTLRFITKVNINC
INQNNGVVDHRSVQMLARWSREYNIKTMLQEIRRIMTMKENLKLAQPPEG
SCFASFLDH

BO18916.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:06:53
Subject Length Description Subject Range Query Range Score Percent Strand
Uev1A-PB 103 CG10640-PB 1..103 1..103 557 100 Plus
Uev1A-PC 145 CG10640-PC 43..145 1..103 557 100 Plus
Uev1A-PA 145 CG10640-PA 43..145 1..103 557 100 Plus
Ubc6-PC 151 CG2013-PC 36..114 6..87 136 34.9 Plus
Ubc6-PA 151 CG2013-PA 36..114 6..87 136 34.9 Plus