Clone BO19658 Report

Search the DGRC for BO19658

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:196
Well:58
Vector:pDNR-Dual
Associated Gene/Transcriptcora-RC
Protein status:BO19658.pep: Imported from assembly
Sequenced Size:2143

Clone Sequence Records

BO19658.complete Sequence

2143 bp assembled on 2010-10-20

GenBank Submission: KX798100

> BO19658.complete
GAAGTTATCAGTCGACATGCCGGCGGAAATTAAACCATCCGCGCCCGCTG
AGCCGGAAACGCCGACCAAGAGCAAACCCAAGTCCAGCTCATCCTCGCAC
GGAAAGCCTGCCCTAGCACGAGTCACCCTGCTGGATGGCTCCCTTCTGGA
CGTGTCCATTGATCGCAAAGCCATTGGCCGTGATGTGATCAACTCAATCT
GCGCCGGTCTGAACCTCATCGAAAAGGACTACTTTGGTCTGACCTATGAG
ACGCCCACAGATCCGCGCACTTGGCTGGATCTGGAGAAGCCGGTATCCAA
GTTCTTCCGCACGGACACTTGGCCTCTCACCTTCGCCGTCAAGTTCTATC
CGCCGGAGCCATCGCAGCTGAAGGAGGACATCACGCGCTACCATTTGTGC
CTGCAGGTGCGCAATGACATCCTGGAGGGTCGACTGCCCTGCACATTCGT
CACCCACGCTCTGCTCGGATCCTACTTGGTGCAGTCGGAGATGGGCGACT
ACGATGCAGAGGAAATGCCCACCAGGGCCTACCTGAAGGACTTCAAGATC
GCTCCAAATCAGACGGCTGAGTTGGAGGATAAGGTCATGGATCTTCACAA
GACCCACAAGGGACAATCGCCCGCCGAGGCTGAGCTACACTACCTGGAGA
ATGCCAAGAAGCTGGCCATGTACGGCGTGGACTTGCATCCCGCTAAGGAT
TCTGAGGGCGTGGACATCATGCTGGGCGTTTGTGCCTCCGGTTTGCTCGT
CTACCGCGATAAATTGCGCATCAACCGCTTTGCCTGGCCCAAGATTCTGA
AGATCTCCTACAAGCGCCACCATTTCTACATCAAGATCCGACCGGGTGAA
TTCGAGCAGTACGAATCCACCATTGGCTTTAAGCTGGCCAACCATCGTGC
CGCCAAGAAACTGTGGAAATCCTGCGTGGAGCACCACACCTTCTTCCGCC
TGATGACCCCCGAACCGGTCAGCAAGTCCAAGATGTTCCCAGTCTTCGGG
TCCACCTATCGCTACAAGGGTCGCACTCAGGCCGAGAGCACGAACACACC
CGTGGATCGTACTCCTCCGAAGTTCAATAGGACTCTGTCCGGAGCTCGTC
TCACTTCCAGGAGCATGGATGCTCTGGCCTTGGCCGAAAAGGAAAAGGTG
GCTAGGAAGAGCAGCACCCTGGATCATCGGGGAGATCGCAATGCCGATGG
CGATGCCCACAGCCGCAGTCCCATCAAGAACAAGAAGGAGAAGTTGATGC
GACAGTCGAGCACCGGCACGGCTTCGGCCTCCTCGCAAAGTTCCCTCGAG
GGTGACTACGAGACCAACCTAGAGATTGAGGCCATCGAGGCTGAGCCCCC
CGTTCAGGATGCTGATAAGGAGGCTAAGTTGCGTGAGAAGAAACAAAAGG
AGAAGGAGGAGAAGGAGCGAAAGGAGCGGGAGAAGCGGGAGTTGGAGGAG
AAGAAGAAGGCCGAAAAGGCTGCCAAGGCAGCACTTGCCGCTGGTGCCGC
TGCAGGAGCGGCTGTTAATGGCAATGACGAGCTGAATGATTCCAACAAGT
CTGACAAGTCCTCAGGCAGACGTGCTGATGCTACACCCACCGACCTGAGT
GGCGCCTATGTCACGGCCACCGCAGTCACCACCCGCACCGCCACCACGCA
CGAGGATCTGGGCAAGAACGCCAAGACGGAGCAGCTGGAGGAGAAGACGG
TGGCCACCACCCGCACCCACGATCCCAACAAGCAGCAGCAGCGCGTCGTT
ACCCAGGAGGTGAAGACGACGGCGACGGTCACCAGTGGGGATCAGAAATC
TCCGCTGTTTACGACCTCCGCCACCACTGGACCCCATGTGGAAAGCACCC
GAGTGGTTCTCGGTGAGGACACACCCGGATTCTCCGGACATGGCGAAATC
ATCTCCACCCAAACCGTGAGCAGCAAAACCCGCACTGTGGAAACCATTAC
CTACAAAACCGAACGCGATGGCATTGTGGAGACCCGAGTGGAACAGAAGA
TAACCATTCAGTCCGATGGAGATCCGATCGATCATGACAAAGCCTTGGCC
GAGGCAATACAAGAAGCGACGGCCATGAATCCGGACATGACAGTCGAGAA
GATTGAAATTCAGCAGCAAACGCAGGCAAGCTTTCTAGACCAT

BO19658.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
cora-RC 2112 CG11949-PC 1..2109 17..2125 10545 100 Plus
cora-RB 2670 CG11949-PB 1..1546 17..1574 7575 99.2 Plus
cora-RG 5091 CG11949-PG 1..1227 17..1243 6135 100 Plus
cora-RB 2670 CG11949-PB 2116..2667 1574..2125 2760 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:08:55
Subject Length Description Subject Range Query Range Score Percent Strand
cora-RC 2914 CG11949-RC 372..2480 17..2125 10545 100 Plus
cora-RB 3472 CG11949-RB 372..1917 17..1574 7575 99.2 Plus
cora-RG 5893 CG11949-RG 372..1598 17..1243 6135 100 Plus
cora-RB 3472 CG11949-RB 2487..3038 1574..2125 2760 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19235763..19236209 164..610 2235 100 Plus
2R 25286936 2R 19236485..19236843 763..1121 1795 100 Plus
2R 25286936 2R 19242174..19242395 1574..1795 1110 100 Plus
2R 25286936 2R 19238148..19238315 1354..1521 840 100 Plus
2R 25286936 2R 19242701..19242859 1793..1951 795 100 Plus
2R 25286936 2R 19236267..19236419 610..762 765 100 Plus
2R 25286936 2R 19235516..19235662 17..163 735 100 Plus
2R 25286936 2R 19236941..19237063 1121..1243 615 100 Plus
2R 25286936 2R 19237326..19237442 1242..1358 585 100 Plus
2R 25286936 2R 19243069..19243180 1952..2063 560 100 Plus
2R 25286936 2R 19243250..19243317 2058..2125 325 98.5 Plus
2R 25286936 2R 19238381..19238435 1520..1574 275 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:08:53 has no hits.

BO19658.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:47:41 Download gff for BO19658.complete
Subject Subject Range Query Range Percent Splice Strand
cora-RC 370..2478 17..2127 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:29:27 Download gff for BO19658.complete
Subject Subject Range Query Range Percent Splice Strand
cora-RC 372..2480 17..2127 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:07:21 Download gff for BO19658.complete
Subject Subject Range Query Range Percent Splice Strand
cora-RC 372..2480 17..2127 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:07:21 Download gff for BO19658.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19243255..19243317 2063..2127 96   Plus
2R 19243069..19243179 1952..2062 100 -> Plus
2R 19242704..19242859 1796..1951 100 -> Plus
2R 19242174..19242395 1574..1795 100 -> Plus
2R 19238382..19238434 1521..1573 100 -> Plus
2R 19238152..19238314 1358..1520 100 -> Plus
2R 19237328..19237441 1244..1357 100 -> Plus
2R 19236942..19237063 1122..1243 100 -> Plus
2R 19236485..19236843 763..1121 100 -> Plus
2R 19236267..19236419 610..762 100 -> Plus
2R 19235763..19236208 164..609 100 -> Plus
2R 19235516..19235662 17..163 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:29:27 Download gff for BO19658.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15130760..15130822 2063..2127 96   Plus
arm_2R 15130574..15130684 1952..2062 100 -> Plus
arm_2R 15130209..15130364 1796..1951 100 -> Plus
arm_2R 15129679..15129900 1574..1795 100 -> Plus
arm_2R 15125887..15125939 1521..1573 100 -> Plus
arm_2R 15125657..15125819 1358..1520 100 -> Plus
arm_2R 15124833..15124946 1244..1357 100 -> Plus
arm_2R 15124447..15124568 1122..1243 100 -> Plus
arm_2R 15123990..15124348 763..1121 100 -> Plus
arm_2R 15123772..15123924 610..762 100 -> Plus
arm_2R 15123268..15123713 164..609 100 -> Plus
arm_2R 15123021..15123167 17..163 100 -> Plus

BO19658.pep Sequence

Translation from 16 to 2143

> BO19658.pep
MPAEIKPSAPAEPETPTKSKPKSSSSSHGKPALARVTLLDGSLLDVSIDR
KAIGRDVINSICAGLNLIEKDYFGLTYETPTDPRTWLDLEKPVSKFFRTD
TWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALL
GSYLVQSEMGDYDAEEMPTRAYLKDFKIAPNQTAELEDKVMDLHKTHKGQ
SPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKL
RINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLW
KSCVEHHTFFRLMTPEPVSKSKMFPVFGSTYRYKGRTQAESTNTPVDRTP
PKFNRTLSGARLTSRSMDALALAEKEKVARKSSTLDHRGDRNADGDAHSR
SPIKNKKEKLMRQSSTGTASASSQSSLEGDYETNLEIEAIEAEPPVQDAD
KEAKLREKKQKEKEEKERKEREKRELEEKKKAEKAAKAALAAGAAAGAAV
NGNDELNDSNKSDKSSGRRADATPTDLSGAYVTATAVTTRTATTHEDLGK
NAKTEQLEEKTVATTRTHDPNKQQQRVVTQEVKTTATVTSGDQKSPLFTT
SATTGPHVESTRVVLGEDTPGFSGHGEIISTQTVSSKTRTVETITYKTER
DGIVETRVEQKITIQSDGDPIDHDKALAEAIQEATAMNPDMTVEKIEIQQ
QTQASFLDH

BO19658.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
cora-PC 703 CG11949-PC 1..703 1..703 3610 100 Plus
cora-PE 699 CG11949-PE 1..699 1..703 3333 90.2 Plus
cora-PB 889 CG11949-PB 1..603 1..589 2680 87.8 Plus
cora-PF 1600 CG11949-PF 1..491 1..519 2460 93.1 Plus
cora-PG 1696 CG11949-PG 1..481 1..519 2454 92.7 Plus
cora-PB 889 CG11949-PB 705..889 519..703 926 99.5 Plus
cora-PF 1600 CG11949-PF 1467..1600 567..703 564 84.7 Plus