Clone BO19661 Report

Search the DGRC for BO19661

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:196
Well:61
Vector:pDNR-Dual
Associated Gene/Transcriptbin-RA
Protein status:BO19661.pep: Imported from assembly
Sequenced Size:2062

Clone Sequence Records

BO19661.complete Sequence

2062 bp assembled on 2010-10-20

GenBank Submission: KX798481

> BO19661.complete
GAAGTTATCAGTCGACATGATTAAAAGTGAAGAAGCCTCCGATCGTTCGG
TTATGACCATGGATCAGCTGGGTGGCTACTACCACGATCCCCGCGCCCAT
CCCCCTTTCAGCCACCCACATGCACACTCCCACCCACATCAACACACCCA
CACTGGACATCCATATAGAGCTGGGAATCTGTTAACCGGTGGCAATTACC
AGGCAATGGGTGGCGGAGAATCACCCACGGAGCTGATCGATGAGAAACCG
AACATCGGGTATATGGAGCTAAAGCATTATATGGACGCTACGCCCACTGC
CACGCCCGTTTCGGCAGCACAACATTATAGCCTAAGTGCGCTGCACAGCA
TGGGTACACCGCCGGCATCCTCCAGTCCCATACCACCGTACGGGGTTCTA
ATGACTGCCCATTCGGCTGGATCCGCTTCTCCGCAATCGAATTCGAAGAC
GCCCACGGATCTGCCGCAGGATTTGCAGTATGCGAGCTCCAGCACATCAA
CCGCCAAGGTGCAGCCATTGCAGGTGCAGCTGCAGCCACTCAACCATCAG
TACGCGTCCACCATTAAGTACTGCTCCAACAACACCATACTCAGTGCGAA
CGACTACCAATTGCTGACCAGCCAGGAGCAGGCGGGGCAACAGCAGCCGC
AGCAGTTGCCAGCCCAGCAGCTCCAGCATTCACCAGGCGGTGGCTACATG
TCGCGCATTTCCACATCGCCGTCGCAGGTGATCAGCAATGCGCACGGCAT
GCCCGTGCTAAACTACTCCAGCTCGAGTTCCTCGCCTGCCAAGTCGCTCA
ACGGTTCCGAATCCTCGCCGCCCAGTCAGAATCATCTGGAGAACAAGGTT
TCGGGCTCAGCGGTGGTTGGTACAGGTGGTTCCAGTCAGCAGGATGCGCC
GAGCACTCCGGATACCACCAAGAAGTCTGGTACCCGGCGGCCAGAGAAAC
CAGCACTCAGCTATATCAATATGATTGGGCATGCGATCAAGGAATCACCA
ACTGGAAAGCTAACGCTCTCCGAGATCTACGCCTACTTGCAGAAGAGCTA
CGAATTCTTTCGAGGACCCTACGTGGGCTGGAAGAACTCGGTGCGCCACA
ATCTCAGCCTGAACGAGTGCTTCAAGAAGCTGCCAAAGGGCATGGGCGTG
GGCAAGCCGGGCAAGGGCAACTACTGGACCATTGACGAGAACTCGGCTCA
TCTCTTCGAGGACGAGGGCAGCCTGAGGCGCCGGCCGCGTGGCTATCGCT
CCAAGATCAAGGTGAAGCCGTATGCCGGCCATGCCAATGGATACTACGCC
AGCGGCTATGGCGATGCGGGAATGGACAATGGCAACTATTACGCCTCGCC
TGCCTTTGCTAGCTACGATTACAGTGCAGCTGGAGCCACTGGCGTCTCGC
CGGCTGGTGGTCAAGGATTCGCCGATCCCTGGAACGCCCATGCCGCCCAC
AGTGGCTCGTCGTCGGTGGGCGTGGGCATGGGCGTGGGTCCCCTGCCCCA
GTATACGAACATATCCTGCCTGGCAGCCGGAGGCAATGTGAATGGCTCGG
CTACCACGCCCCCGCTGGCCCACTCCGCACTGGGAATGGCCCCATCGGCA
TCATCCTCAAGTTCGCCACTGGGAGCGGCGGCGACGCTTCAAAGCGATTA
TGCGCCAACCGCGAGTCTCGTGGCCGCTGGCTATTCCTATGCAACAAGTG
CCGGCAGCCTGGACAACGGCCTCCGTTCGATTTCGCTGCAGCAGCTGCCC
GGATTGTCCAGCATCCAGCATGCCCAGGCTCAGGCCCAAGCACAGGCGCA
CCACCATCACCATCAGCACCATGCGAGCCACCCCAGCCACAGCCATCAGG
GCCACGGATCCATGCACCAGAATCACGGCACATCATCCACGACGCCACCA
CCATCGCAGTCCGGTGGCAGCCATGGGATCGATCATTCGCCCATTGATCG
CAAGCCGGCCTACCTGCCGCCCATCAGCCCGCCCCCCATGATGGTGGCTC
TGAATGGGGGCGGTGGATACTACGAGGGACTCAAGTACGCCAACGCAAGC
TTTCTAGACCAT

BO19661.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:15:21
Subject Length Description Subject Range Query Range Score Percent Strand
bin-RA 2031 CG18647-PA 1..2028 17..2044 10140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
bin-RA 2412 CG18647-RA 210..2237 17..2044 10140 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6990831..6991861 17..1047 5155 100 Plus
3L 28110227 3L 6993023..6993418 1324..1719 1980 100 Plus
3L 28110227 3L 6993946..6994272 1718..2044 1635 100 Plus
3L 28110227 3L 6992674..6992953 1046..1325 1400 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:15:20 has no hits.

BO19661.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:13 Download gff for BO19661.complete
Subject Subject Range Query Range Percent Splice Strand
bin-RA 210..2237 17..2046 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:30:15 Download gff for BO19661.complete
Subject Subject Range Query Range Percent Splice Strand
bin-RA 210..2237 17..2046 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:40 Download gff for BO19661.complete
Subject Subject Range Query Range Percent Splice Strand
bin-RA 210..2237 17..2046 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:40 Download gff for BO19661.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6993947..6994272 1719..2046 99   Plus
3L 6993024..6993417 1325..1718 100 -> Plus
3L 6992676..6992952 1048..1324 100 -> Plus
3L 6990831..6991861 17..1047 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:30:15 Download gff for BO19661.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6987047..6987372 1719..2046 99   Plus
arm_3L 6986124..6986517 1325..1718 100 -> Plus
arm_3L 6985776..6986052 1048..1324 100 -> Plus
arm_3L 6983931..6984961 17..1047 100 -> Plus

BO19661.pep Sequence

Translation from 16 to 2062

> BO19661.pep
MIKSEEASDRSVMTMDQLGGYYHDPRAHPPFSHPHAHSHPHQHTHTGHPY
RAGNLLTGGNYQAMGGGESPTELIDEKPNIGYMELKHYMDATPTATPVSA
AQHYSLSALHSMGTPPASSSPIPPYGVLMTAHSAGSASPQSNSKTPTDLP
QDLQYASSSTSTAKVQPLQVQLQPLNHQYASTIKYCSNNTILSANDYQLL
TSQEQAGQQQPQQLPAQQLQHSPGGGYMSRISTSPSQVISNAHGMPVLNY
SSSSSSPAKSLNGSESSPPSQNHLENKVSGSAVVGTGGSSQQDAPSTPDT
TKKSGTRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRG
PYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGKGNYWTIDENSAHLFEDE
GSLRRRPRGYRSKIKVKPYAGHANGYYASGYGDAGMDNGNYYASPAFASY
DYSAAGATGVSPAGGQGFADPWNAHAAHSGSSSVGVGMGVGPLPQYTNIS
CLAAGGNVNGSATTPPLAHSALGMAPSASSSSSPLGAAATLQSDYAPTAS
LVAAGYSYATSAGSLDNGLRSISLQQLPGLSSIQHAQAQAQAQAHHHHHQ
HHASHPSHSHQGHGSMHQNHGTSSTTPPPSQSGGSHGIDHSPIDRKPAYL
PPISPPPMMVALNGGGGYYEGLKYANASFLDH

BO19661.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:40:12
Subject Length Description Subject Range Query Range Score Percent Strand
bin-PA 676 CG18647-PA 1..676 1..676 3605 100 Plus
fkh-PD 510 CG10002-PD 3..305 86..408 274 29.1 Plus
fkh-PB 510 CG10002-PB 3..305 86..408 274 29.1 Plus
fkh-PA 510 CG10002-PA 3..305 86..408 274 29.1 Plus
fkh-PE 518 CG10002-PE 3..305 86..408 274 29.1 Plus