Clone BO19664 Report

Search the DGRC for BO19664

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:196
Well:64
Vector:pDNR-Dual
Associated Gene/TranscriptCG31033-RC
Protein status:BO19664.pep: Imported from assembly
Sequenced Size:1846

Clone Sequence Records

BO19664.complete Sequence

1846 bp assembled on 2010-10-20

GenBank Submission: KX799611

> BO19664.complete
GAAGTTATCAGTCGACATGTCTACGGAGGAGCATGTGTGGCGAGCGCACG
TCGTGCGGCGCTTACGCGAGCGAAATCGCAAGGAGTGCGACAACTTCAAG
GAGATCATCGAGCAAAACAACCGACTGATTGACCATGTGGCGCAACTGAA
GGCGGACAACCTGAAGATCTCCGTCGAAAACGAGCAGCTCCGCAACGCGG
TGTCAACAGGTGGCACCGGCTCCAACGTGGCTATCGCCACCCTCGAAAAG
AAGCTGCTCAGCCAGCAGGAGGAGCTCACAGAGCTACACAAGCGCAAGGG
CGAGAACTCCCAGATGATCGTGGACCTCAACCAGAAGGTCGAGCAGCAGA
GGATCATAATTTCCGAGAAGGAGCACAGCCTCGTCGAACAGCAAACGAAC
AACAACCGATTGCGCGCGGAGGTGCAGCTACTTCACTCGAGTTTGGAGGA
ACTCAAGAAGCTGAACAACACAATGCTGGACGAACATACGGCGCTTCAAT
TGGCATTTAGCTCCCTCGAGGAGAAGTTAAGGGGAGTGCAAGATGAAAAT
CGGCGTCTACTGGAGCGACTTATGCAATACAAGTCAAAGGATGCCGACAA
GTTGAACGAGGAAAACGAGAGCATAATTAGGAAACGTTCGGCTAAACTGA
AACGTGACCTAGAAGACGCGGTTCGTGAGCCCAGTTCGTCCAGCAACGCC
GCCTCCTCGCCCGGCGCCGCATCCTTGCAGCGCAACTCCAGTCCCGCCCA
GTTCGTTGGCGGCCTCATCGGCGACGAGGATTTCGACGAGGCTGCGATAA
ATGGCGCCATGGAGGCCATAGGTCTCGATGATAATGAATATATTAGCGCT
CGTTTTACAGCAGGCGAAATCGCCGAGAACTCGCGGGCTTCCATCGACAC
CCTGAAGGCCACGGGCTACCTGGGCCAGGCCAATCCCACCAAGATCCTCA
TGAAGTTCGAGGCCCACGAGAACGAGTCGCACGCGGTGCGCTGGAGTCCC
GTGGAGCGCATGGTGGCCACCGGTGGCGCTGATCGCAAAGTCAAACTTTG
GGACATTGGCAAAAATTCCACCGAACCACGTGCCGTTCTAAGCGGGAGCA
GTGCTGGGATTAACTCCGTAGATTTCGATTCGACAGGCGCCTACATCCTG
GGCACCTCCAATGACTACGGAGCCAGAGTATGGACAGTGATGGACAATCG
CTTAAGACACACGCTGACGGGTCACAGCGGCAAGGTAATGGCCGCCAAGT
ACGTCCAGGAGCCCATCAAAGTGGTGACCGGTAGCCACGATCGCACACTG
AAGATCTGGGATTTGCGCAGCATCGCCTGCATAGAGACGAAGTTCGCCGG
CTCCAGCTGCAATGATCTAGTCACCACCGACAGCCTCGGATCAACGATCA
TCAGTGGGCACTACGATAAGAAGATCCGGTTCTGGGACATACGCACCGAG
AAGCAGGCGGACGACGTCTTAATGCCGGCCAAGATCACCTCTTTGGATTT
GTCAAAAGATTGCAATTACCTCATATGCTCTGTAAGAGACGATACTATTA
AACTGTTAGATTTACGCAAGAACCAAGTTATATCCACGTTTACAAACGAA
CACTTTAAGATCAGCTGTGATTTTGCTCGAGCTTCTTTCAACTCGAGCGG
CCTGAAGATCGCTTGTGGATCAGCGGATGGCGCTATATACATTTGGAATG
TGAATGGGTTCCTGGAAGCCACACTCAAGGGACACAGCACCGCCGTAAAC
GCGGTCAGTTGGAGTCCCAACAACAACATGCTGGCCTCCGTGGGAAAGAA
CAAGCGCTGCACCATCTACTCGGAGTCAGCAAGCTTTCTAGACCAT

BO19664.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:19:43
Subject Length Description Subject Range Query Range Score Percent Strand
Atg16-RC 1815 CG31033-PC 1..1812 17..1828 9030 99.9 Plus
Atg16-RB 1338 CG31033-PB 49..1335 542..1828 6405 99.8 Plus
Atg16-RA 1260 CG31033-PA 1..1257 572..1828 6255 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:19:45
Subject Length Description Subject Range Query Range Score Percent Strand
Atg16-RC 2350 CG31033-RC 255..2068 15..1828 9040 99.9 Plus
Atg16-RB 1668 CG31033-RB 100..1386 542..1828 6405 99.8 Plus
Atg16-RA 1659 CG31033-RA 91..1377 542..1828 6405 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:19:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29831915..29832350 1064..629 2165 99.8 Minus
3R 32079331 3R 29828226..29828526 1508..1208 1505 100 Minus
3R 32079331 3R 29834361..29834622 378..117 1310 100 Minus
3R 32079331 3R 29833932..29834097 542..377 830 100 Minus
3R 32079331 3R 29831690..29831832 1207..1065 715 100 Minus
3R 32079331 3R 29827850..29827993 1737..1594 705 99.3 Minus
3R 32079331 3R 29834746..29834847 116..15 510 100 Minus
3R 32079331 3R 29827563..29827657 1828..1734 475 100 Minus
3R 32079331 3R 29833192..29833281 631..542 450 100 Minus
3R 32079331 3R 29828073..29828159 1593..1507 435 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:19:42 has no hits.

BO19664.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:23 Download gff for BO19664.complete
Subject Subject Range Query Range Percent Splice Strand
CG31033-RC 257..2068 17..1830 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:30:47 Download gff for BO19664.complete
Subject Subject Range Query Range Percent Splice Strand
Atg16-RC 257..2068 17..1830 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:11:04 Download gff for BO19664.complete
Subject Subject Range Query Range Percent Splice Strand
Atg16-RC 257..2068 17..1830 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:11:04 Download gff for BO19664.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29834746..29834845 17..116 100   Minus
3R 29834361..29834622 117..378 100 <- Minus
3R 29833933..29834095 379..541 100 <- Minus
3R 29833193..29833281 542..630 100 <- Minus
3R 29831915..29832348 631..1064 99 <- Minus
3R 29831690..29831832 1065..1207 100 <- Minus
3R 29828226..29828526 1208..1508 100 <- Minus
3R 29828073..29828157 1509..1593 100 <- Minus
3R 29827850..29827993 1594..1737 99 <- Minus
3R 29827559..29827653 1738..1830 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:30:47 Download gff for BO19664.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25660468..25660567 17..116 100   Minus
arm_3R 25660083..25660344 117..378 100 <- Minus
arm_3R 25659655..25659817 379..541 100 <- Minus
arm_3R 25658915..25659003 542..630 100 <- Minus
arm_3R 25657637..25658070 631..1064 99 <- Minus
arm_3R 25657412..25657554 1065..1207 100 <- Minus
arm_3R 25653948..25654248 1208..1508 100 <- Minus
arm_3R 25653795..25653879 1509..1593 100 <- Minus
arm_3R 25653572..25653715 1594..1737 99 <- Minus
arm_3R 25653281..25653375 1738..1830 97 <- Minus

BO19664.pep Sequence

Translation from 16 to 1846

> BO19664.pep
MSTEEHVWRAHVVRRLRERNRKECDNFKEIIEQNNRLIDHVAQLKADNLK
ISVENEQLRNAVSTGGTGSNVAIATLEKKLLSQQEELTELHKRKGENSQM
IVDLNQKVEQQRIIISEKEHSLVEQQTNNNRLRAEVQLLHSSLEELKKLN
NTMLDEHTALQLAFSSLEEKLRGVQDENRRLLERLMQYKSKDADKLNEEN
ESIIRKRSAKLKRDLEDAVREPSSSSNAASSPGAASLQRNSSPAQFVGGL
IGDEDFDEAAINGAMEAIGLDDNEYISARFTAGEIAENSRASIDTLKATG
YLGQANPTKILMKFEAHENESHAVRWSPVERMVATGGADRKVKLWDIGKN
STEPRAVLSGSSAGINSVDFDSTGAYILGTSNDYGARVWTVMDNRLRHTL
TGHSGKVMAAKYVQEPIKVVTGSHDRTLKIWDLRSIACIETKFAGSSCND
LVTTDSLGSTIISGHYDKKIRFWDIRTEKQADDVLMPAKITSLDLSKDCN
YLICSVRDDTIKLLDLRKNQVISTFTNEHFKISCDFARASFNSSGLKIAC
GSADGAIYIWNVNGFLEATLKGHSTAVNAVSWSPNNNMLASVGKNKRCTI
YSESASFLDH

BO19664.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Atg16-PC 604 CG31033-PC 1..604 1..604 3073 100 Plus
Atg16-PF 612 CG31033-PF 1..612 1..604 3054 98.7 Plus
Atg16-PB 445 CG31033-PB 16..445 175..604 2210 100 Plus
Atg16-PA 419 CG31033-PA 1..419 186..604 2156 100 Plus
wds-PB 361 CG17437-PB 71..354 317..600 323 29.4 Plus