Clone BO19691 Report

Search the DGRC for BO19691

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:196
Well:91
Vector:pDNR-Dual
Associated Gene/TranscriptCG42699-RC
Protein status:BO19691.pep: Imported from assembly
Sequenced Size:2725

Clone Sequence Records

BO19691.complete Sequence

2725 bp assembled on 2010-10-20

GenBank Submission: KX795351

> BO19691.complete
GAAGTTATCAGTCGACATGTCGCAGGTGCTTAGCCCCCACAAACAGGGCG
TGTCGGAGGCGGATGCGTTGGACTACACGAACAGCAGCTCGATCATCGAG
TTCCTGGCCAAAGAGCAGGACTGCGGCGGAATACTGAACGATCCGGACCC
GGAGTCCATATTCCAGGAGGTGAGTCGCCTGTCCGACAGCACAGATATGC
GATCCGTGGATGAATTGCTGCAGGAAGCGGAGCGCCTGATCCAACAGCAG
TTGCGTCTCGGCGGTATTGTTCCAAAACTGGACGCTTCCGGGCCCCCTGC
TCCGACCAAAACCCTCGGAGAAGAAGCTGCCACCGGTGGTGATGGCTCTT
CCTCATCCCCGCAGTCCTCGCCGCATAGCAGCATACGGCTGAATACACGC
TATACCCATCGCATCGAGCATTCGCCTGCTCCCTTGGCGCCAAAAACCGT
CGCAGTCAATGGCAGAGTCCGGCCCAGATCCGGTTCCAAATCGTCGGCCT
CGCCAACATCGGTGCAGACGCCGCTAGAAAGCAGCAATGGATGCGGCTTT
GCCGCCTTCGTGGATAACCTGCCATCGGCGTCGGTCATTTCCGAGGAGTC
CACGCCCAAGGACATGGACATGGAGAACCATACGGCGGCCATGGCAAAGC
TGCAACTCCAGCAGCTTCAGGATAATACCGATGACGACGAGGATACGATG
GAGGAGATCACCGAGGCGGAGGTGGACGCCCCCATATTTTCGCGAGCTGA
GGACACTGGCAAAGAGGTCAGGAGTCCGCCTGAAAGGCAGTTTAAGAGTC
AAGGGCGTTCATACATCCAGCCCAGTCAGCCGATTCGACCGATGGCCAGC
TACAGCGAGAAGGCGGTGGGCAGCTCACCCAAGCGCATGGTCAGCACCTT
GACCTCACCCATCGAGCAGATCGCCAGTAGTGTTTCGCGGGAGCATGCGC
TTAAGCTGGAGATCGAGCAACTGCAGGAGCGACTCAAGGACACCGAGGAG
CGTCTGGCCTCCGTTCGCCTTCAGAGCGACTCGCTGTCGCAGACGCAACG
TGCGCTGCGGGAGCACAACAGCCGGCTGCAGGAGGAGTCCGAGATGCTAA
AGCTGGACGTGCAGCATCTCAATGAGTGCGCCAATGTCTTGAGGTCGGAA
CTGCAGGCGGCTCGCAGGGATCGTGGCGAGGCGCTCCAGATGCAGCGCTC
CCTGCGAGATGAACTCGAGGAGGCGAACCAGGAGCGGCGGCGAACTGGTG
AGGGTAAAGAGAAGGACAGCCGCGTCATCCAGGATCTGCAACGCCAGTGC
CGCGAGATGGAGCGCATACTGATGCGCAAGCATCCGGACTCCGTGTCCGC
TCTGATAGTGGCGTCCAAGAGTTCGGGCATGTGTCCGCTTAACGACCAGG
AGAACGTGAATAGTCGCAAACTGCTGGAGCAGCGCATCGCCCAGCTCGAA
TCGGATGCCAAGGAGCAGGATCGCAAGGCGCAACAGATTCTGGCCAATGT
CCAGGCGCGCTTCAATTCGGTGCAGGCCAAATATGAGACTCACATCGCGG
ACCTGGAGACGCAGGTTTTAAGCCTTCAGGAGATAAACACAAAACTAAAC
GAGCAGATAGAATCACAGGTGCGCACCCTAGATCGGTATATGCAAAAGAG
GGCGGATAGATACTACAACAATTGCACCCAAACTGAGCCATTAGAAGAGG
ATGATGTATCAGTCGGCGGTGGAGTAAACCACGGACGAGCTACCCCGGTT
AGCTCGAACACAATGGGCACCCAAACCCAGGCGGCGAATGGAACGCGGGA
TCATAGTACCAATACCATTGGCTGCCCCTCGCCGGCACTTGTGTGCCAGC
AGCAGCATCTCCACCAAGCGCATGGCCACCTCCATCCACATGCCCCGTCC
GCAAGCAGCAGCACCAGCAGCACCGCCAATTCCACGCCGAACACGTCGCG
TCCGAACTCGAAACAAAGTGGCGGTCAAAGGCGTTCGCCACTGGTCACCG
CGGGCCCCTCAAAGCTGCCCATCTCGCAGTCGGACTCAACGCTCTCACTG
CTCAGCCATGGCGGCGGAGGATCCAAGGAGGAGGCACAGTTGCTCAGCTC
CGTGAGGAGTATGCGCGTGGATCTGGCCATTAAAAACAAGGCAATGCAGC
GTTTAACACGGGAGTTGGATGAATGCAAAAAGACCATACGGAAGCTGCAG
CGGGACAAGGAGGGTAGTGGCTCCGGCAGCCAAACAGGCAGCAAACTGGA
TCTAAGGTCCCAGGCTAGCGGCGGAGCCATGCAGCAGAGGCGCTCCAGTG
GCTATGATCACCATCACCACAGTGATCACATTCCGGCGGCCACCGAAAGT
CAGGCTCTGAAGGAGGCCCAAAACAAGTACCGTCTGCTGGAGGCCGACTA
TAAAACTCTTCATGACAAGCGGCTGCAGGATCTGAAGACCCTGCAGAGTG
CCCACGAAAGGGAACTGGCCTCCTGCAACGAGACCGTGCGTATACTGCAG
CAGCGCCTCAACGAGCGGGAGGAGGCACTGACCACCCAGAAGCGGCGCAA
GGTGCCCGTGGATTACTATGCCCTGAAAGCCAAGGTATCGCTTTTGGAAA
GGAGGCACTCGGAGCGGGAGGAGAGACTTCATATGCTGGTGGAGGCACTC
AGCAAGGGACGGCTCAACGGTGCTCTCGAGGATCTGATGCAGGAGAACAA
CAACAAGGCAAGCTTTCTAGACCAT

BO19691.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG42699-RC 2694 CG42699-PC 1..2691 17..2707 13455 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG42699-RC 4296 CG42699-RC 362..3053 16..2707 13460 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5764914..5765595 16..697 3410 100 Plus
X 23542271 X 5785455..5786122 1571..2238 3340 100 Plus
X 23542271 X 5784439..5785100 697..1358 3310 100 Plus
X 23542271 X 5785164..5785380 1356..1572 1085 100 Plus
X 23542271 X 5787636..5787832 2235..2431 985 100 Plus
X 23542271 X 5787895..5788050 2432..2587 780 100 Plus
X 23542271 X 5788207..5788333 2581..2707 635 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:07:08 has no hits.

BO19691.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:47:32 Download gff for BO19691.complete
Subject Subject Range Query Range Percent Splice Strand
CG4064-RA 1..2010 698..2709 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:29:09 Download gff for BO19691.complete
Subject Subject Range Query Range Percent Splice Strand
CG42699-RC 363..3053 17..2709 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:06:50 Download gff for BO19691.complete
Subject Subject Range Query Range Percent Splice Strand
CG42699-RC 363..3053 17..2709 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:06:50 Download gff for BO19691.complete
Subject Subject Range Query Range Percent Splice Strand
X 5788211..5788333 2585..2709 98   Plus
X 5787895..5788047 2432..2584 100 -> Plus
X 5787639..5787832 2238..2431 100 -> Plus
X 5785457..5786121 1573..2237 100 -> Plus
X 5785167..5785380 1359..1572 100 -> Plus
X 5784440..5785100 698..1358 100 -> Plus
X 5764915..5765595 17..697 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:29:09 Download gff for BO19691.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5682244..5682366 2585..2709 98   Plus
arm_X 5681928..5682080 2432..2584 100 -> Plus
arm_X 5681672..5681865 2238..2431 100 -> Plus
arm_X 5679490..5680154 1573..2237 100 -> Plus
arm_X 5679200..5679413 1359..1572 100 -> Plus
arm_X 5678473..5679133 698..1358 100 -> Plus
arm_X 5658948..5659628 17..697 100 -> Plus

BO19691.pep Sequence

Translation from 16 to 2725

> BO19691.pep
MSQVLSPHKQGVSEADALDYTNSSSIIEFLAKEQDCGGILNDPDPESIFQ
EVSRLSDSTDMRSVDELLQEAERLIQQQLRLGGIVPKLDASGPPAPTKTL
GEEAATGGDGSSSSPQSSPHSSIRLNTRYTHRIEHSPAPLAPKTVAVNGR
VRPRSGSKSSASPTSVQTPLESSNGCGFAAFVDNLPSASVISEESTPKDM
DMENHTAAMAKLQLQQLQDNTDDDEDTMEEITEAEVDAPIFSRAEDTGKE
VRSPPERQFKSQGRSYIQPSQPIRPMASYSEKAVGSSPKRMVSTLTSPIE
QIASSVSREHALKLEIEQLQERLKDTEERLASVRLQSDSLSQTQRALREH
NSRLQEESEMLKLDVQHLNECANVLRSELQAARRDRGEALQMQRSLRDEL
EEANQERRRTGEGKEKDSRVIQDLQRQCREMERILMRKHPDSVSALIVAS
KSSGMCPLNDQENVNSRKLLEQRIAQLESDAKEQDRKAQQILANVQARFN
SVQAKYETHIADLETQVLSLQEINTKLNEQIESQVRTLDRYMQKRADRYY
NNCTQTEPLEEDDVSVGGGVNHGRATPVSSNTMGTQTQAANGTRDHSTNT
IGCPSPALVCQQQHLHQAHGHLHPHAPSASSSTSSTANSTPNTSRPNSKQ
SGGQRRSPLVTAGPSKLPISQSDSTLSLLSHGGGGSKEEAQLLSSVRSMR
VDLAIKNKAMQRLTRELDECKKTIRKLQRDKEGSGSGSQTGSKLDLRSQA
SGGAMQQRRSSGYDHHHHSDHIPAATESQALKEAQNKYRLLEADYKTLHD
KRLQDLKTLQSAHERELASCNETVRILQQRLNEREEALTTQKRRKVPVDY
YALKAKVSLLERRHSEREERLHMLVEALSKGRLNGALEDLMQENNNKASF
LDH

BO19691.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:38:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG42699-PC 897 CG42699-PC 1..897 1..897 4520 100 Plus
zip-PH 1964 CG15792-PH 851..1437 314..889 166 19.4 Plus
zip-PG 1971 CG15792-PG 843..1429 314..889 166 19.4 Plus
zip-PE 1971 CG15792-PE 843..1429 314..889 166 19.4 Plus
zip-PC 1971 CG15792-PC 843..1429 314..889 166 19.4 Plus