Clone BO19695 Report

Search the DGRC for BO19695

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:196
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptUlp1-RA
Protein status:BO19695.pep: Imported from assembly
Sequenced Size:4573

Clone Sequence Records

BO19695.complete Sequence

4573 bp assembled on 2010-10-20

GenBank Submission: KX797194

> BO19695.complete
GAAGTTATCAGTCGACATGTCGCTGCCTCCCGAGGACACCGATTTGTCCA
CAAATTCCGCATACGAATCCGCACTCCAAATCGCGAGCAATGTGTCGGCA
GCACGAGTAGTCGGTTCGGCAGTAGGACAGCGATTTTCGCCGTCGCCAGC
AGCTCACCCGAACGTGATTGAGCGCGTCGCGTCTCATGTGGACTCACGCC
GCAGCACGTTTCCAAGTTGGGGTAATCCGTCAGTAGCGCCAAGAGGATCG
GAAGAAGCAGCAGCCAACGCCACAGCAACACAACTCCTATGGGCGGAGAA
CCAAGGTCTCCCGACATCGCACTTATTGCCAACTGAACAGGCATTCGAGA
CATTGAACACTAATGCGTATTGTTCCCCGCCAGGGGATTCACGATTTACG
TTCCCTAGCCAGAACTACTCGCCGCTGCTGCCGCGGTGTGTCCCAGTTCC
GAATCAGCGTTACTCTCCAGATGGATCGCCAATACATCAACTCCATGAGC
TGCAAAATTGTCCATTGATAGATTCGCCGATAAGACTGCGATTTCCATCC
CCCTTGCCAGAACCACCATCACTACCGACCATCACCCTTACAGTTGATGC
CCTGATCGATCTTGACCAAAACAACCAGGTCGCATATTATGTCCAGCAGT
ACAACAATCAGCCAGTCCTATATCAACAAAACATTCATATAGGAACGGGA
ATCCAACTATGCGATCAGGCCTCCGAGAATAATCAACCGATTATATTACA
TATCGTGGAGCACAATCCCCAGACTATAACTGAGAGCCAGGAGCAATTCC
ACCAGGTTGTCCCCGAAATTCAAATCAATAATATCCAGGAGCAAGATCAG
AAATTTGAAAATGGCATCTCGGAACAAAATCATCCGATTGCAACTGAGGC
TCAGGATCAGACTTTAACTGAGATCCGGGATGAAAACCAGATTGTCCTTG
CAGTCCAAGAAAAAAATCTCACGCGTGCCTCTGAGATTCAGGACCAGAAC
CAACAGACATTAACCGAGATCCCAGAGAAATGTCTTCAGATTGCATCTCC
TGTCACTACTGATATACAGGTACAAAGTCCTCAGGTTGTAATAGAGATCC
AGGAGCAAAATCACCAGTCTGTAACGGAGATCCAGGAGGAAGTTCACCAG
ACTGCCCCCGAAATCCAAGTGAACGTTTTCCAGACCTCGTCTGATATTCA
AGGGCAAAATCACCAGATTGTAACTGAAGAGCAAAATCATCAGACTATAA
CCGAGACCCAGGAGGATTACTCGGCTGTCTCCGAAATCCAATGGGAAAAT
CTCTCGTTTTCTGCTGAGATTCAGGAGCAAAACCAGCAGATCGTAACCGA
AGTTACGAAGCTTGCATCTCCTTCTGTTACTGATATACAGGCACAAAGTC
CTCAGTCCGTAATCGAGATCCAGGATGACGATGATGAAGATCTAAAGTTC
GAATCTGATGATCTGCACACTATACCTGAAATCCAGGAGAAAAACCAACA
AAGTCCTCAGTTCGTAATCGAGATCCATTATGATAATGAAGATCTAAAGT
TCGCATCTGATAATCAGGAGCAAGATCAACAAACAGCCGAGCTCCAAAAG
GAAAGGTTCCAGTTCGCATCTGAAATCGAGAAGCGAGATCTGCAGATTGT
TACTGACACTCACAAACAAAATTATCACAATGTAACCGACATCCCGTTCG
CAACATACATCCAGGAGGAAAACGAGCAGTTAACACCGGAAGACCAAGAG
GAAGATCAACATTACCTGAATTTTGAGGGGAACCAACAATTCCAGCTCCA
GAAGCAAGATCAGCTGAGTGTACCACAGATCCAGAAGCAAACCCACCAGT
TCGAATCTAAGGTCAAAAAGAGAAAGTTGCAGCCCTTTTCTGAATACCAG
CAGAAAGGTCAGAAAGATCATATCCAAGAGAGGCAGTATATTCAGCAGGA
ATTCACCATCCACTCTAACCAGGCTTATTCTAAGGTCCAGTATATACAAA
CTATACAAACTGCGACTCCGTACGTACCTCAATTGGAAATATCCCAGGAA
AACAGTTTTGAGGTTCAACCAGCATACGAGGTAAACGAAGGCCAACGGGA
CAGAGAACTGGTTAGTTACACAGGCCACGAGCATCAGAACTTTGTTGATG
AGGTCTCGACACCATTACCGCCCGCTGAAGCTCAACCAGGATCTACTTCA
GAAGATATATCAGACCCCGTTTCACCTGAACATTGGGAGCAGCTAGAGTC
ACTCGATCCGAGCACTATTTGTATTCGCAAAACCTTCAATCTAATTCGCG
ATATCTCTGAAAGTCTGGTGGCCGATCCAGAGCAACCCGAAGCCGAAGCC
CACCGGAAGTCAATTTTCCTTCTCCGCCAGAAGCTAGCCGATGTGTGCCA
TAAGGTTCTAACCGAAATTATACACGGCCGGGCCACCGATGAGATCATCT
CCATTCTGAGAGAGATTCTCGAGCAAACTAAGGAAATACCTCCACGCCCC
ACGCCGAAAAGAGACCTCCAAGAAGACATTTCGATGGGCTTAGAAATATT
AAAAAAGATCCGTGGTATGCTATCCGGTTGGTATTCTTCCAGAGAAAGCG
AAACGGACTCCACGGATACCGGAACGGGATTCCAGGCTCAAAACGGAAAA
GGTTTTGGTGCCGGCCGCCAGCCGGAAAATAGTTTTTTATCCCAGAAAAG
ACGCAACCAAGAAGAGAACCCTCGTCTGATCAAGTACCGGCGTGTGGACA
ACAGCTTTCCCCGCTTGATAACGAATGAGACGGCCGAGGACCTGATTCCC
AACAATTCGATGGCCAAGCGGGATCAGCCCCAGAGCTCAAAGCGGCTCTC
AATATTTAATCCGCCGGTATACACGCAGCACCGAGTGCGCAATGATGCCC
CCCACGTACCTACGCCATTTGACGATGAGGAGTCGTCACAGAGACTTGCT
AACGCGGGCCCATCATCCAGGCCCATGACTTACTCGGATGCGGTGCGTCT
AGGCCATAATGGCATCTCCGAGTCGCGCGTAAATGGGCACTCCAGCCATA
CGGTGCGCAGAGAACCGTCTCGGCTGCACAGAAGCATTCTGTCCCACGAG
ATGAACTGCAAGGATCAAGAGCAGTATAACGAACTTATCCGTACCCAAAC
AAATTACGTGGGCAGTCGCTACCTCAAGCCGGGTACCCCGCCAACGTTTC
AGCGGGCTAAAGCCCAGTCGGCAACCAGTAGCAGCTGCTCACTGCAAGAC
AACCAATCGAATATAACAGATTCGTTCCCGTCGCCACATGGCCGTGCGAA
CCCTGAGCTAACGGAGTACGCCAAATTGATCAACCGCCAGGAGAATGAGG
AGAACAGGTCTCCGGCACCACAGCAGCCAAAGCGAAACGCTAGCAATAGC
TCTGCCAGCCATGCGTCCACTATTTCCAGCAGCGCATCTTCCTCCTGCAG
CACTTGTTCAACTTGCTCATCTTCTGACACTGAGCCAATGTTGGTTAAAG
ATAGCCCGGAGGTCAAGGAAGCCAACGAAGCCAACGAGGCCAACGAAGCC
AACGAAGCCAACGAAACCAAGGAAAATGACGCACCTCAACCTACAACTAC
CAGAATCAAGAAACCAGACTTCTTGCACCGTCGCTTTGCCAACTGTATCT
TTCTAAGGAATGACTTTGCGGAAAATTTCAAAGCAAGAGCGAATCGCCGG
CAACTTGAATCCATGCATCTTCTTGGAATAGCTGAACAGCAGGCTAATGA
AAGCAAAGATGAACGCCTTGCCTATGAAAAAAAGCTGCGGGAAGTCATGT
TCCGGTCTGGTGCTCCCCACCGGCCCTTTTTTGAAATCGGGCCCCTGGAA
CAGCCGGAAGAGAAGAAAGAGACCAAGCTCATTCCGCTAACAAAGGAGGA
CCACGCTCGCTTTCAAGAAATGACAACTATTGAGGTTACGACGAACTTAA
TTTTCAAATATAACCTACAAATAACTACCGACGACATATTCACGTTTGTT
GATGGCGAATGGCTTAACGACGCGATCATCAACTTTTACATGTCCATGCT
GACGGAACGCTCGGAGAAGCGAGCTGGCGAACTTCCCGCCACTTACGCCA
TGAACACATTCTTCATGCCCCGTCTCCTGCAAGCTGGGTATGCAGGCGTT
AGGCGCTGGACTCGCAAAGTGGACTTGTTCAGCAAGGACATAATACCGGT
GCCAGTGCACTGCGGCAACGTCCACTGGTGCATGGCCATCATACACTTGC
GTAACAAGACAATCTTCTATTACGACTCAATGGGAAGACCAAACCAACCG
GCGCTTGATGCTCTAGTTAAATATCTGCACGAAGAGTCACTAGACAAGCG
CAAACAGCCGTTTGATATGACCGGTTTCGTTGTCGAGAACGCGCAGAATA
TACCACGTCAAGGGAATAGCAGCGATTGCGGTGTCTTCAGCTGCATGTTC
GCCGAGTATATAACGCGTGATGTTCCGATTACCTTCTCCCAGGCGGAAAT
GTTGTACTTCCGCACGAAGATGGCCCTGGAAATCGCCGACGGAAAGTTGT
GGCAGGCAAGCTTTCTAGACCAT

BO19695.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
Ulp1-RA 4542 CG12359-PA 1..4539 17..4555 22695 100 Plus
CG11023-RC 1443 CG11023-PC 648..1442 3757..4551 1980 83.3 Plus
CG11023-RC 1443 CG11023-PC 1..348 2810..3145 760 81.9 Plus
CG11023-RD 819 CG11023-PD 1..348 2810..3145 760 81.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
Ulp1-RA 5498 CG12359-RA 187..4726 16..4555 22700 100 Plus
CG11023-RC 1802 CG11023-RC 799..1597 3757..4555 1985 83.2 Plus
CG11023-RD 1844 CG11023-RD 1034..1639 3950..4555 1800 86.5 Plus
CG11023-RC 1802 CG11023-RC 45..499 2703..3145 1085 83.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19205073..19207760 2703..16 13440 100 Minus
X 23542271 X 19204064..19204937 3576..2703 4370 100 Minus
X 23542271 X 19202875..19203487 4555..3943 3065 100 Minus
2L 23513712 2L 8674..9279 3950..4555 1800 86.5 Plus
2L 23513712 2L 7573..8027 2703..3145 1085 83.1 Plus
X 23542271 X 19203566..19203767 3943..3742 1010 100 Minus
X 23542271 X 19203826..19203991 3742..3577 830 100 Minus
2L 23513712 2L 8403..8571 3757..3925 275 77.5 Plus
Blast to na_te.dros performed on 2014-11-26 15:14:48 has no hits.

BO19695.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:10 Download gff for BO19695.complete
Subject Subject Range Query Range Percent Splice Strand
Ulp1-RA 185..4723 17..4557 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:30:09 Download gff for BO19695.complete
Subject Subject Range Query Range Percent Splice Strand
Ulp1-RA 185..4723 17..4557 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:28 Download gff for BO19695.complete
Subject Subject Range Query Range Percent Splice Strand
Ulp1-RA 188..4726 17..4557 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:28 Download gff for BO19695.complete
Subject Subject Range Query Range Percent Splice Strand
X 19205073..19207759 17..2703 100   Minus
X 19204064..19204936 2704..3576 100 <- Minus
X 19203827..19203991 3577..3741 100 <- Minus
X 19203566..19203767 3742..3943 100 <- Minus
X 19202873..19203486 3944..4557 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:30:09 Download gff for BO19695.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19099106..19101792 17..2703 100   Minus
arm_X 19098097..19098969 2704..3576 100 <- Minus
arm_X 19097860..19098024 3577..3741 100 <- Minus
arm_X 19097599..19097800 3742..3943 100 <- Minus
arm_X 19096906..19097519 3944..4557 99 <- Minus

BO19695.pep Sequence

Translation from 16 to 4573

> BO19695.pep
MSLPPEDTDLSTNSAYESALQIASNVSAARVVGSAVGQRFSPSPAAHPNV
IERVASHVDSRRSTFPSWGNPSVAPRGSEEAAANATATQLLWAENQGLPT
SHLLPTEQAFETLNTNAYCSPPGDSRFTFPSQNYSPLLPRCVPVPNQRYS
PDGSPIHQLHELQNCPLIDSPIRLRFPSPLPEPPSLPTITLTVDALIDLD
QNNQVAYYVQQYNNQPVLYQQNIHIGTGIQLCDQASENNQPIILHIVEHN
PQTITESQEQFHQVVPEIQINNIQEQDQKFENGISEQNHPIATEAQDQTL
TEIRDENQIVLAVQEKNLTRASEIQDQNQQTLTEIPEKCLQIASPVTTDI
QVQSPQVVIEIQEQNHQSVTEIQEEVHQTAPEIQVNVFQTSSDIQGQNHQ
IVTEEQNHQTITETQEDYSAVSEIQWENLSFSAEIQEQNQQIVTEVTKLA
SPSVTDIQAQSPQSVIEIQDDDDEDLKFESDDLHTIPEIQEKNQQSPQFV
IEIHYDNEDLKFASDNQEQDQQTAELQKERFQFASEIEKRDLQIVTDTHK
QNYHNVTDIPFATYIQEENEQLTPEDQEEDQHYLNFEGNQQFQLQKQDQL
SVPQIQKQTHQFESKVKKRKLQPFSEYQQKGQKDHIQERQYIQQEFTIHS
NQAYSKVQYIQTIQTATPYVPQLEISQENSFEVQPAYEVNEGQRDRELVS
YTGHEHQNFVDEVSTPLPPAEAQPGSTSEDISDPVSPEHWEQLESLDPST
ICIRKTFNLIRDISESLVADPEQPEAEAHRKSIFLLRQKLADVCHKVLTE
IIHGRATDEIISILREILEQTKEIPPRPTPKRDLQEDISMGLEILKKIRG
MLSGWYSSRESETDSTDTGTGFQAQNGKGFGAGRQPENSFLSQKRRNQEE
NPRLIKYRRVDNSFPRLITNETAEDLIPNNSMAKRDQPQSSKRLSIFNPP
VYTQHRVRNDAPHVPTPFDDEESSQRLANAGPSSRPMTYSDAVRLGHNGI
SESRVNGHSSHTVRREPSRLHRSILSHEMNCKDQEQYNELIRTQTNYVGS
RYLKPGTPPTFQRAKAQSATSSSCSLQDNQSNITDSFPSPHGRANPELTE
YAKLINRQENEENRSPAPQQPKRNASNSSASHASTISSSASSSCSTCSTC
SSSDTEPMLVKDSPEVKEANEANEANEANEANETKENDAPQPTTTRIKKP
DFLHRRFANCIFLRNDFAENFKARANRRQLESMHLLGIAEQQANESKDER
LAYEKKLREVMFRSGAPHRPFFEIGPLEQPEEKKETKLIPLTKEDHARFQ
EMTTIEVTTNLIFKYNLQITTDDIFTFVDGEWLNDAIINFYMSMLTERSE
KRAGELPATYAMNTFFMPRLLQAGYAGVRRWTRKVDLFSKDIIPVPVHCG
NVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRKQPFD
MTGFVVENAQNIPRQGNSSDCGVFSCMFAEYITRDVPITFSQAEMLYFRT
KMALEIADGKLWQASFLDH

BO19695.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
Ulp1-PA 1513 CG12359-PA 1..1513 1..1513 7882 100 Plus
CG11023-PC 480 CG11023-PC 128..480 1169..1511 1156 62.6 Plus
CG32110-PA 411 CG32110-PA 111..411 1204..1513 717 47.1 Plus
CG11023-PC 480 CG11023-PC 1..132 932..1057 442 68.2 Plus
CG11023-PD 272 CG11023-PD 1..132 932..1057 442 68.2 Plus
CG11023-PB 284 CG11023-PB 1..132 932..1057 442 68.2 Plus
CG11023-PD 272 CG11023-PD 114..266 1166..1309 273 40.5 Plus