Clone BO19814 Report

Search the DGRC for BO19814

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:198
Well:14
Vector:pDNR-Dual
Associated Gene/Transcriptesn-RA
Protein status:BO19814.pep: Imported from assembly
Sequenced Size:2389

Clone Sequence Records

BO19814.complete Sequence

2389 bp assembled on 2010-10-20

GenBank Submission: KX794378

> BO19814.complete
GAAGTTATCAGTCGACATGCAGCAGGCCCCGCAGCAGCAGCAGCATCCCC
ATCCGCCCAGCAGCAGCTACTACACGCAAACCGAAAGCGAGCTGCTGCAG
ATTGAGGCGGGCGGCACGGGCCTGACCTTCGCCTCCCACTCGCAACGTCC
CGAATCGGCGATCAGTCAGGTGGCATCCACCGCCCACCTGGACGTGCCCT
CGGCCGCCTCCAGCGGCAGCGGGGGCAGTGCAGTCAGTGGGGGAAGCGGC
GGAGCTCCGGAATCCGCGGGTCGATTTGTGTCCCCGCTGCAGCGCCGCCA
CTGCCAGCCGCCCAGCCACCTGCCGCTGAACTCGGTGGCCTCCCCGCTCC
GCACCGCCAGCTACAAGTCGGCGGCGGCGGTCGCTGGTCATGGCTTCCAC
CACAGCCATCACCAGCAGCTGGACTTCCAGCGGAACTCGCAGTCGGACGA
CGACAGCGGCTGTGCCCTCGAGGAGTACACTTGGGTGCCGCCGGGTCTGC
GGCCCGATCAGGTCCGTTTGTACTTCAGTCAACTGCCAGACGACAAAGTG
CCCTACGTCAACAGTCCCGGCGAAAAGTATCGTGTCAAGCAGTTGCTGCA
CCAGCTGCCGCCGCAAGATAACGAAGTGCGCTACTGCCACTCGCTGAGCG
ACGAGGAGCGCAAGGAGCTGCGCATCTTCTCGGCCCAAAGGAAGCGGGAG
GCCCTCGGACGAGGGGCGGTCCGTCTGCTGTCCGACGAGCGGCCCTGCAA
GGGGTGCGAGGAGCCTTTGTCCGGCGGTGACATCGTGGTTTTCGCCCAGC
GCCTGGGCGCCCAGTTGTGTTGGCATCCGGGCTGCTTTGTGTGCAGCGTC
TGCAAGGAGCTCCTGGTGGACCTCATCTACTTCCAGCGGGACGGGAACCT
CTACTGCGGTCGGCACCATGCCGAAACCCAGAAGCCACGCTGCTCCGCCT
GCGATGAGATCATCTTCTCGGACGAGTGCACGGAGGCGGAGGGCAGAACG
TGGCACATGAAGCACTTCGCCTGCCAGGAGTGCGAGCACCAGCTGGGCGG
GCAGCGGTACATCATGCGGGAGGGCAAACCGTACTGTCTGGCCTGCTTCG
ACACAATGTTCGCCGAGTACTGCGACTACTGCGGGGAGGTAATCGGCGTG
GACCAGGGCCAGATGAGCCACGACGGGCAGCACTGGCATGCGACGGACCA
GTGCTTCAGCTGCTGCACCTGCCGCTGTTCGCTGCTGGGAAGGCCCTTCC
TGCCCAGAAGGGGCACCATCTACTGCTCGATCGCCTGTAGCAAAGGTGAG
CCGCCCACGCCGTCAGACACGAGTTCGGGTCCCCAGCTAAGGCCGACTCA
CCGAGCTTCCACCTCCAGCCAAATAGCTAAATCGCCGCGTAGAGGTGGAG
AGCGGGAGCGGGATCCGGGACGGAAGGCCCACCACGGTCACCCGAAGGCT
ACGGGCAGTGCAGGCGATCTGCTTGAGCGGCAGGAAAGGCAGCGCATGGA
GGCCGCGGGAGTGGCGGACCTACTGCTCGGAGGAGGAGTACCGGGCATGC
CTCGCCCAGCCCATCCACCGCCCATCGACCTAACCGAGTTGGGGATCAGC
CTGGACAACATTTGTGCCGGCGACAAGTCCATCTTCGGGGACACCCAGAC
CCTGACCAACTCCATGCCGGACATGCTGCTATCCAAGGCTGACGACTCGC
ACAGTTACCAGAGCATCGACAAAATCAACCTGAACTCGCCCAGCAACTCT
GATCTGACGCAGAGCACCCAGGAACTGGCCAACGAGCTGGAGCTGGACAA
CGAGCCGGTGCGGGAGCTGCCCCACGATGGCTACGAACAGCTCTTCGCTA
ACAATCGCAACCAGGAGCACCCGGCCGAACAATATGACGACGAGCAGCTG
GACAACCGACCGATGAAGGAGGTGCGCTTTCACAGCGTCCAGGACACTAT
GTCGCGCTCAAAGAGCTACACGGATAACTCCAATGCCCGGCGGCGGAGGA
GGCGTCGCAACCAGTCGCGCAGCTCCTCGGAGATGCAGATCAACCAAACG
AACCTCCGCCTGCACAACGCACAAACGCAGGTGGGAACGACTCCCCTCAA
TCTGCTAAACAATCTGGACAACTGCGACGTGGCCAGCATCTGCTCCACCT
GCTCATCCAGCTCCTCGAGCGACATGGACGACTACGTATACCGCCTGCCT
GCGCGGAAACACTACGGCGGAGTGAGAGTGGCCTATGTGCCCAACGATGC
GTTGGCCTATGAGCGCAAGAAGAAGATGGCCCAGGACTCGTCCCTGGCCC
CCGGGGCAGGCAATGCATCCGTGGGCGGGGCACCGGCGATCATGCACGAG
AGCAAGAACTGCACGATTTCCGCAAGCTTTCTAGACCAT

BO19814.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
esn-RC 3405 CG43722-PC 1046..3402 15..2371 11770 100 Plus
esn-RD 2556 CG43722-PD 1..2355 17..2371 11760 100 Plus
esn-RA 2358 CG43722-PA 1..2355 17..2371 11760 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
esn-RD 3982 CG43722-RD 582..2938 15..2371 11770 100 Plus
esn-RC 4708 CG43722-RC 1308..3664 15..2371 11770 100 Plus
esn-RA 3982 CG43722-RA 582..2938 15..2371 11770 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7125410..7126824 957..2371 7060 99.9 Plus
2R 25286936 2R 7118479..7118977 15..513 2495 100 Plus
2R 25286936 2R 7221014..7221362 971..1319 1085 87.4 Plus
2R 25286936 2R 7124987..7125191 754..958 1025 100 Plus
2R 25286936 2R 7120524..7120652 626..754 645 100 Plus
2R 25286936 2R 7119803..7119922 509..628 600 100 Plus
2R 25286936 2R 7220740..7220877 821..958 300 81.2 Plus
2R 25286936 2R 7209477..7209570 420..513 275 86.2 Plus
2R 25286936 2R 7219052..7219171 509..628 225 79.2 Plus
Blast to na_te.dros performed on 2014-11-26 15:12:24 has no hits.

BO19814.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:47:54 Download gff for BO19814.complete
Subject Subject Range Query Range Percent Splice Strand
esn-RA 584..2938 17..2373 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:29:49 Download gff for BO19814.complete
Subject Subject Range Query Range Percent Splice Strand
esn-RA 584..2938 17..2373 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:33 Download gff for BO19814.complete
Subject Subject Range Query Range Percent Splice Strand
esn-RA 584..2938 17..2373 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:33 Download gff for BO19814.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7125412..7126824 959..2373 99   Plus
2R 7124988..7125191 755..958 100 -> Plus
2R 7120524..7120652 626..754 100 -> Plus
2R 7119806..7119919 512..625 100 -> Plus
2R 7118481..7118975 17..511 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:29:49 Download gff for BO19814.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3012917..3014329 959..2373 99   Plus
arm_2R 3012493..3012696 755..958 100 -> Plus
arm_2R 3008029..3008157 626..754 100 -> Plus
arm_2R 3007311..3007424 512..625 100 -> Plus
arm_2R 3005986..3006480 17..511 100 -> Plus

BO19814.pep Sequence

Translation from 16 to 2389

> BO19814.pep
MQQAPQQQQHPHPPSSSYYTQTESELLQIEAGGTGLTFASHSQRPESAIS
QVASTAHLDVPSAASSGSGGSAVSGGSGGAPESAGRFVSPLQRRHCQPPS
HLPLNSVASPLRTASYKSAAAVAGHGFHHSHHQQLDFQRNSQSDDDSGCA
LEEYTWVPPGLRPDQVRLYFSQLPDDKVPYVNSPGEKYRVKQLLHQLPPQ
DNEVRYCHSLSDEERKELRIFSAQRKREALGRGAVRLLSDERPCKGCEEP
LSGGDIVVFAQRLGAQLCWHPGCFVCSVCKELLVDLIYFQRDGNLYCGRH
HAETQKPRCSACDEIIFSDECTEAEGRTWHMKHFACQECEHQLGGQRYIM
REGKPYCLACFDTMFAEYCDYCGEVIGVDQGQMSHDGQHWHATDQCFSCC
TCRCSLLGRPFLPRRGTIYCSIACSKGEPPTPSDTSSGPQLRPTHRASTS
SQIAKSPRRGGERERDPGRKAHHGHPKATGSAGDLLERQERQRMEAAGVA
DLLLGGGVPGMPRPAHPPPIDLTELGISLDNICAGDKSIFGDTQTLTNSM
PDMLLSKADDSHSYQSIDKINLNSPSNSDLTQSTQELANELELDNEPVRE
LPHDGYEQLFANNRNQEHPAEQYDDEQLDNRPMKEVRFHSVQDTMSRSKS
YTDNSNARRRRRRRNQSRSSSEMQINQTNLRLHNAQTQVGTTPLNLLNNL
DNCDVASICSTCSSSSSSDMDDYVYRLPARKHYGGVRVAYVPNDALAYER
KKKMAQDSSLAPGAGNASVGGAPAIMHESKNCTISASFLDH

BO19814.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
esn-PD 851 CG43722-PD 1..785 1..785 4224 100 Plus
esn-PC 1134 CG43722-PC 350..1134 1..785 4224 100 Plus
esn-PA 785 CG43722-PA 1..785 1..785 4224 100 Plus
esn-PB 785 CG43722-PB 1..785 1..785 4224 100 Plus
pk-PA 963 CG11084-PA 109..546 63..498 1470 63.4 Plus