Clone BO19836 Report

Search the DGRC for BO19836

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:198
Well:36
Vector:pDNR-Dual
Associated Gene/TranscriptCG9590-RA
Protein status:BO19836.pep: Imported from assembly
Sequenced Size:1414

Clone Sequence Records

BO19836.complete Sequence

1414 bp assembled on 2010-10-20

GenBank Submission: KX799312

> BO19836.complete
GAAGTTATCAGTCGACATGGCAAAAAATCCAAAAAAGGAGGAGGACGGCG
GTAACGACTGGGCCCAAAGTGACGAGGACGACAACTGGGACGATTGGGGC
GATGACGATGACAAGTTCGTTCACGTGGAGAAGGAACAGCAGCCACAGGA
GAAAGTCTCGAGCAGAAACGACGCAAAAGGAACGGCGGAAAATCAGGAAA
AGCTGGAAACTCCCAGAATTTCTGCTCCAGCAACAGCATCCGCCACATCC
TCGTCCTGGGGTCTGTGGGGCGGTAAACTGAGCTCCGTGCTAACCACCGC
CACGGAGGGATTGGGCACGATAACCACCCAAGTCAACCAGGGGCTTAATC
AAATCATCGGAGTGCCCGATCCCGAGGAGCTGGCTCGCATTAATGTGGCT
GAAAAGGCGGAAAAGGCTGCTAAAGCGCCGCCAGAGGAAAATGTCGACGA
TGAAAAAGAATCTTCGGCCGCCTTTGGCTTGGACTTTGTCACCAATCTGG
GCTCCAAGGTTCTCAACACCGGACTGGATACACTCGAGGGCATTGGCAAG
AAGACCATGACCATCCTGCAGGACAACGATCCCAAGCTGATGAACAAGAG
GAAACTGCTCGGTCTGGAGGCCAACTCGCCTAATTTGAGTGCCGTGTTGC
TGGAGGCAAAGAAGGAGGCCGACCAAATGGAGCAATCCCTGCAACAGCTA
CAGCTGAAAAGACAGAAGGCGCAGCTGCGTTTCGAAATCCTTTTCGAAAA
TTACTGCGGCCTGGTGCACTTCGAGGCCCTGGAGATCCTTTCCAAGGAGT
CACGCCTCAAACTGGACACCCTACTCGATGCGGTTAGTGGCAATGCCCGT
GCAGAGTTGCAGGAAACGATAAACGAGGTGAAGGAACTGATCGAACTGGA
GGATCTGGATGTGGAGAGTGAAGGTGACTACGAGGCGGAGGAACTGAGCG
AGCGATTGGCGGCCACAATCAAGGACGCCGAGCTGGGCATTCAGTTTGAC
GACATAGCCAATCACTGGACGCAGTCCCTCAGCTGGTTGACCTCAGAGGA
AGCAACTGCCGCCGATCTGGAGCAAGCCTATGCTAAGAGCATCCACGCGC
TGAGTGAAGCGTGCGCCCTCGAGATGTGTAAGCTGCACAAAATCGCCGAG
CTGTTGCTGGTGAAGCCACATCACAGCACCGCCAACGAAGTGGATGGCGT
CGTCAATCTCTGCCAGCAGTTCAATGGACACCTTCAAGGACTTAGCCACC
GCTTCGCCGCCGTTCTGAGCGGCAAGTCAGAAACGGAGGAATCAAAAGGC
CGGGTCAGCACATTCTTTTCCGAAATGCTATCTGCCGTGCAGTTCATCGA
GAAGGCCTACAAGCTATTTACACCCATTCTCCAGATGGGAGCTGTGGCAA
GCTTTCTAGACCAT

BO19836.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:08:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG9590-RA 1383 CG9590-PA 1..1380 17..1396 6900 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG9590-RA 1578 CG9590-RA 62..1441 17..1396 6900 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:08:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15786764..15787758 17..1011 4975 100 Plus
3R 32079331 3R 15787818..15788202 1012..1396 1925 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:08:10 has no hits.

BO19836.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:47:39 Download gff for BO19836.complete
Subject Subject Range Query Range Percent Splice Strand
CG9590-RA 64..1443 17..1398 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:29:20 Download gff for BO19836.complete
Subject Subject Range Query Range Percent Splice Strand
CG9590-RA 62..1441 17..1398 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:07:10 Download gff for BO19836.complete
Subject Subject Range Query Range Percent Splice Strand
CG9590-RA 62..1441 17..1398 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:07:10 Download gff for BO19836.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15787818..15788202 1012..1398 99   Plus
3R 15786764..15787758 17..1011 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:29:20 Download gff for BO19836.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11613540..11613924 1012..1398 99   Plus
arm_3R 11612486..11613480 17..1011 100 -> Plus

BO19836.pep Sequence

Translation from 16 to 1414

> BO19836.pep
MAKNPKKEEDGGNDWAQSDEDDNWDDWGDDDDKFVHVEKEQQPQEKVSSR
NDAKGTAENQEKLETPRISAPATASATSSSWGLWGGKLSSVLTTATEGLG
TITTQVNQGLNQIIGVPDPEELARINVAEKAEKAAKAPPEENVDDEKESS
AAFGLDFVTNLGSKVLNTGLDTLEGIGKKTMTILQDNDPKLMNKRKLLGL
EANSPNLSAVLLEAKKEADQMEQSLQQLQLKRQKAQLRFEILFENYCGLV
HFEALEILSKESRLKLDTLLDAVSGNARAELQETINEVKELIELEDLDVE
SEGDYEAEELSERLAATIKDAELGIQFDDIANHWTQSLSWLTSEEATAAD
LEQAYAKSIHALSEACALEMCKLHKIAELLLVKPHHSTANEVDGVVNLCQ
QFNGHLQGLSHRFAAVLSGKSETEESKGRVSTFFSEMLSAVQFIEKAYKL
FTPILQMGAVASFLDH

BO19836.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG9590-PA 460 CG9590-PA 1..460 1..460 2333 100 Plus