Clone BO19866 Report

Search the DGRC for BO19866

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:198
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptCG11155-RA
Protein status:BO19866.pep: Imported from assembly
Sequenced Size:2764

Clone Sequence Records

BO19866.complete Sequence

2764 bp assembled on 2010-10-20

GenBank Submission: KX796920

> BO19866.complete
GAAGTTATCAGTCGACATGGTACGAAAAAAACGAGAAATCGTAATAAAGG
AAAATATTCAAGGACGAAGTTACCTTAAAAAAATATGTTGTTCGTATATA
ATACTGTCCATCCTCGTAATTTCTAATGCCTTGCCCCCAGTAATACGAGT
AGGTGCCATATTTACGGAAGATGAACGCGAAAGCAGTATTGAATCTGCAT
TTAAATACGCAATATACCGTATAAATAAGGAAAAGACTCTTCTTCCCAAT
ACACAATTGGTTTACGATATTGAGTATGTTCCCCGAGATGACTCGTTTCG
CACTACTAAAAAGGTTTGCAGTCAGTTGGAAGCAGGTGTTCAAGCAATTT
TTGGCCCAACAGATGCTCTTTTAGCTAGTCATGTACAATCCATATGCGAA
GCATATGATATACCCCATATTGAAGGTCGAATTGACCTCGAATATAATTC
TAAAGAATTTTCTATAAATTTATATCCGTCGCATACGCTCTTAACTCTAG
CATATAGAGATATAATGGTATATTTGAACTGGACGAAGGTGGCAATAATT
TATGAAGAAGATTATGGTCTATTTAATTTGATGCACTCATCAACTGAGAC
GAAAGCGGAAATGTATATAAGGCAAGCAAGTCCGGATTCCTATCGCCAAG
TTTTACGAGCGATACGTCAAAAGGAAATTTACAAAATAATAGTGGATACA
AATCCGTCCCATATAAAATCGTTTTTTAGATCCATTTTGCAACTACAAAT
GAATGACCATCGTTACCATTATATGTTTACAACATTCGACTTGGAGACAT
ATGATCTGGAAGATTTCAGATATAACAGCGTAAATATAACTGCATTTCGG
CTGGTAGATGTCGATAGCAAAAGATATCTCGAAGTAATTAATCAAATGCA
GAAATTACAACACAATGGATTGGACACTATAAATGGAAGTCCTTATATAC
AGACGGAGTCCGCATTAATGTTTGATTCGGTGTACGCGTTTGCGAATGGA
CTACACTTTCTAAATTTGGATAATCACCAAAATTTTTATATCAAAAACCT
ATCCTGCACCTCCGACCAAACCTGGAATGATGGAATTTCATTGTATAACC
AAATAAATGCAGCCATCACAGACGGACTGACTGGCACTGTCCAATTTGTG
GAAGGTCGGCGAAACATATTTAAGCTTGATATTCTTAAACTAAAGCAAGA
AAAAATACAAAAGGTTGGATATTGGCATCCCGACGACGGTGTTAACATTT
CGGATCCAACAGCTTTCTACGATTCAAATATCGCAAATATAACCTTGGTC
GTTATGACTAGAGAGGAGCGGCCGTATGTTATGGTTAAAGAAGACAAAAA
TCTAACTGGAAATTTGAGGTTTGAAGGATTTTGTATTGATCTTTTAAAAG
CAATCGCCACACAAGTTGGGTTTCAATATAAAATTGAATTAGTTCCCGAT
AATATGTACGGTGTTTACATACCAGAGACTAATTCATGGAATGGAATCGT
GCAGGAATTAATGGAAAGGCGTGCTGATCTTGCTGTAGCCTCAATGACAA
TTAATTATGCTCGGGAAAGTGTTATCGACTTTACCAAACCATTTATGAAC
TTGGGCATTGGCATATTATTCAAGGTGCCGACAAGTCAACCAACACGACT
GTTCTCCTTTATGAACCCTTTGGCAATCGAGATATGGCTTTATGTGCTAG
CTGCATACATATTAGTATCTTTCGCGCTCTTTGTAATGGCTCGATTTTCT
CCATATGAGTGGAAAAACCCCCATCCATGCTACAAGGAAACGGATATAGT
GGAAAATCAGTTTTCCATATCAAACAGTTTTTGGTTTATAACAGGAACAT
TCTTACGCCAAGGATCTGGACTTAATCCGAAGGCAACCTCGACGCGTATT
GTGGGCGGATGCTGGTTCTTTTTTTGCCTAATCATTATATCTTCATACAC
TGCCAACTTAGCTGCATTTCTAACAGTTGAACGGATGATTTCCCCCATTG
AAAGCGCTTCTGATTTGGCAGAGCAAACCGAAATATCATATGGAACTTTG
GAAGGTGGATCGACAATGACATTTTTTAGGGATTCAAAAATTGGTATATA
TCAAAAAATGTGGCGTTATATGGAAAACCGTAAAACAGCTGTATTTGTAA
AAACCTATGAAGACGGAATTAAACGAGTAATGGAAGGAAGCTATGCTTTT
TTGATGGAATCGACAATGCTGGACTATGCTGTTCAACGTGATTGTAATCT
GACCCAAATAGGAGGCCTTCTTGATTCTAAAGGTTATGGTATCGCAACAC
CCAAGGGCTCTCCATGGAGAGATAAAATATCACTTGCTATTTTAGAGCTT
CAAGAAAAGGGTATTATTCAAATATTATATGACAAATGGTGGAAAAATAC
AGGTGACGTTTGCAACAGAGATGATAAGAGCAAGGAGTCCAAAGCCAATG
CACTTGGAGTAGAAAATATTGGTGGCGTGTTTGTTGTTCTCCTTTGTGGA
CTTGCGCTTGCAGTTGTTGTAGCCATATTTGAGTTTTGCTGGAATTCTAG
AAAAAATTTAAATACTGAAAATCAATCTCTGTGTTCAGAAATGGCAGAGG
AACTTCGTTTTGCAATGCACTGCCATGGTTCAAAATCAAGACATAGACCG
CGAAAACGAAGTTGCCTTAATTGTTCGTCTGTACCAACATATGTTCCGAG
TAATGTGAGCACGTCAAATGTGGGCGTTTACTATAATTACTTTAATGCAA
GCTTTCTAGACCAT

BO19866.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG11155-RD 2733 CG11155-PD 1..2730 17..2746 13650 100 Plus
CG11155-RA 2733 CG11155-PA 1..2730 17..2746 13650 100 Plus
CG11155-RB 2568 CG11155-PB 1..1866 17..1882 9330 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG11155-RD 4984 CG11155-RD 149..2878 17..2746 13650 100 Plus
CG11155-RA 2979 CG11155-RA 149..2878 17..2746 13650 100 Plus
CG11155-RB 3644 CG11155-RB 149..2014 17..1882 9330 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 1127000..1127417 151..568 2090 100 Plus
4 1348131 4 1135088..1135486 2075..2473 1980 99.7 Plus
4 1348131 4 1135538..1135813 2471..2746 1380 100 Plus
4 1348131 4 1131699..1131959 1623..1883 1305 100 Plus
4 1348131 4 1131191..1131396 1314..1519 1030 100 Plus
4 1348131 4 1130383..1130587 1112..1316 1025 100 Plus
4 1348131 4 1133873..1134073 1881..2081 1005 100 Plus
4 1348131 4 1128488..1128655 566..733 840 100 Plus
4 1348131 4 1129566..1129730 788..952 825 100 Plus
4 1348131 4 1130023..1130184 951..1112 810 100 Plus
4 1348131 4 1126808..1126943 19..154 680 100 Plus
4 1348131 4 1131488..1131595 1519..1626 540 100 Plus
4 1348131 4 1129435..1129489 734..788 275 100 Plus
4 1348131 4 639089..639205 2397..2281 270 82.1 Minus
Blast to na_te.dros performed on 2014-11-26 15:18:41 has no hits.

BO19866.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:21 Download gff for BO19866.complete
Subject Subject Range Query Range Percent Splice Strand
CG11155-RA 144..2873 17..2748 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:30:40 Download gff for BO19866.complete
Subject Subject Range Query Range Percent Splice Strand
CG11155-RA 149..2878 17..2748 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:10:43 Download gff for BO19866.complete
Subject Subject Range Query Range Percent Splice Strand
CG11155-RA 149..2878 17..2748 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:10:43 Download gff for BO19866.complete
Subject Subject Range Query Range Percent Splice Strand
4 1135539..1135813 2472..2748 99   Plus
4 1135094..1135484 2081..2471 100 -> Plus
4 1133875..1134072 1883..2080 100 -> Plus
4 1131701..1131958 1625..1882 100 -> Plus
4 1131489..1131593 1520..1624 100 -> Plus
4 1131193..1131396 1316..1519 100 -> Plus
4 1130383..1130586 1112..1315 100 -> Plus
4 1130025..1130183 953..1111 100 -> Plus
4 1129566..1129730 788..952 100 -> Plus
4 1129435..1129488 734..787 100 -> Plus
4 1128489..1128655 567..733 100 -> Plus
4 1127002..1127415 153..566 100 -> Plus
4 1126807..1126941 17..152 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:30:40 Download gff for BO19866.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 1156165..1156439 2472..2748 99   Plus
arm_4 1155720..1156110 2081..2471 100 -> Plus
arm_4 1154501..1154698 1883..2080 100 -> Plus
arm_4 1152327..1152584 1625..1882 100 -> Plus
arm_4 1152115..1152219 1520..1624 100 -> Plus
arm_4 1151819..1152022 1316..1519 100 -> Plus
arm_4 1151009..1151212 1112..1315 100 -> Plus
arm_4 1150651..1150809 953..1111 100 -> Plus
arm_4 1150192..1150356 788..952 100 -> Plus
arm_4 1150061..1150114 734..787 100 -> Plus
arm_4 1149115..1149281 567..733 100 -> Plus
arm_4 1147628..1148041 153..566 100 -> Plus
arm_4 1147433..1147567 17..152 99 -> Plus

BO19866.pep Sequence

Translation from 16 to 2764

> BO19866.pep
MVRKKREIVIKENIQGRSYLKKICCSYIILSILVISNALPPVIRVGAIFT
EDERESSIESAFKYAIYRINKEKTLLPNTQLVYDIEYVPRDDSFRTTKKV
CSQLEAGVQAIFGPTDALLASHVQSICEAYDIPHIEGRIDLEYNSKEFSI
NLYPSHTLLTLAYRDIMVYLNWTKVAIIYEEDYGLFNLMHSSTETKAEMY
IRQASPDSYRQVLRAIRQKEIYKIIVDTNPSHIKSFFRSILQLQMNDHRY
HYMFTTFDLETYDLEDFRYNSVNITAFRLVDVDSKRYLEVINQMQKLQHN
GLDTINGSPYIQTESALMFDSVYAFANGLHFLNLDNHQNFYIKNLSCTSD
QTWNDGISLYNQINAAITDGLTGTVQFVEGRRNIFKLDILKLKQEKIQKV
GYWHPDDGVNISDPTAFYDSNIANITLVVMTREERPYVMVKEDKNLTGNL
RFEGFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELME
RRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMN
PLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFS
ISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAA
FLTVERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWR
YMENRKTAVFVKTYEDGIKRVMEGSYAFLMESTMLDYAVQRDCNLTQIGG
LLDSKGYGIATPKGSPWRDKISLAILELQEKGIIQILYDKWWKNTGDVCN
RDDKSKESKANALGVENIGGVFVVLLCGLALAVVVAIFEFCWNSRKNLNT
ENQSLCSEMAEELRFAMHCHGSKSRHRPRKRSCLNCSSVPTYVPSNVSTS
NVGVYYNYFNASFLDH

BO19866.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG11155-PD 910 CG11155-PD 1..910 1..910 4757 100 Plus
CG11155-PA 910 CG11155-PA 1..910 1..910 4757 100 Plus
CG11155-PB 855 CG11155-PB 1..622 1..622 3239 100 Plus
CG9935-PB 899 CG9935-PB 3..889 23..887 2472 53.7 Plus
CG9935-PD 898 CG9935-PD 3..888 23..887 2459 53.7 Plus
CG11155-PB 855 CG11155-PB 758..855 595..692 427 81.6 Plus