Clone BO19876 Report

Search the DGRC for BO19876

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:198
Well:76
Vector:pDNR-Dual
Associated Gene/TranscriptCASK-RA
Protein status:BO19876.pep: Imported from assembly
Sequenced Size:1807

Clone Sequence Records

BO19876.complete Sequence

1807 bp assembled on 2010-10-20

GenBank Submission: KX795674

> BO19876.complete
GAAGTTATCAGTCGACATGTGCCAGCATCATGGGCTGACATCACAGTCGT
TGATGTCCGGTGGCTCGCACATATCCCTGCTGGGCAGCAGCGGCAGCAGC
GGTATGAGCGGCAGCGGCGTCGGCAGCAGCGGTCAGAGTGTCCCGCAATG
TCCCGCCGCTGTGGCAGCCGCGGATGCCGCAATGATGGGCTCCAATGCCG
GCGGCCATTGCCGCAGCCTGAGCGGCCTGAGCTCGATCAGCATACCGCCG
CCGCCGCCGGCGCTCTTCAATCCGTGCAGCTCGGCGCTGTCGCTGCAGCA
GGCGGCGGTAACCAGGTGGGGACCGCGCACCTCCTGCCCGGTCCACAGTC
CGTTTCGTGTGCGCGTGCCGAACGGCTCCATCTGCTCCGGACACCAGGCT
CTGCTCCATAGCCACGATGTGGTGGCCCGGGATGTCTACGGGGAGGAGGC
GCTGCGCGTCACCCCGCCCCCGATGGTGCCCTACCTCAATGGCGACGAGC
TGGACAACGTCGAGGGCGGCGAACTGCAGCATGTGACCCGGGTGCGACTG
GTGCAGTTTCAGAAGAACACGGACGAGCCCATGGGCATCACGCTGAAGAT
GACCGAGGACGGGCGGTGCATTGTGGCCAGGATTATGCACGGCGGGATGA
TTCATCGCCAGGCCACGCTGCACGTGGGCGACGAGATACGGGAGATCAAC
GGCCAGCCGGTGCAGCACCAGTCGGTTGGCCAATTGCAACGAATGCTGCG
CGAGGCACGCGGTTCTGTTACCTTCAAGATAGTTCCTTCGTACCGCAGCG
CTCCGCCCCCCTGCGAGCTTTTCAGGATCAGACCCGCTCCGGTGCTTATA
TTCGTGCGCGCCCAATTCGATTATAATCCGCTGGATGATGAGCTTATACC
CTGCGCCCAGGCGGGCATATCGTTCCAAGTGGGCGATATACTGCAGATTA
TTAGCAAGGACGATCATCACTGGTGGCAGGCGCGACTGGACACGGTGGGC
GGATCGGCCGGACTGATACCGTCGCCGGAGCTGCAGGAGTGGCGGATCGC
CTGCCAGACGGTCGACAAGACCAAGCAGGAGCAGGTTAACTGCTCCATCT
TCGGGCGCAAGAAGAAGCAATGCCGGGACAAATATCTGGCCAAGCACAAT
GCCATCTTCGACACGCTCGATGTGGTCACGTACGAGGAGGTTGTCAAGGT
GCCAGTTGGCGACCCGAACTTTCAGCGCAAAACGTTGGTGCTCTTGGGTG
CTCATGGGGTGGGCAGGCGGCACATTAAGAACACCTTGATATCGAAGTAC
CCCGACAAGTACGCCTATCCCATACCACATACAACGAGACCTGCCAAACC
CGAGGAGGAGAACGGACGCAGCTATTACTTTGTCTCGCACGATGAAATGA
TGGCGGACATCGGTGCGAATGAGTACTTGGAATACGGCACCCACGAGGAT
GCCATGTACGGCACCAAGTTGGACACCATCCGACGGATTCACACCGAGGG
CAAGATGGCCATATTGGATGTGGAGCCGCAGGCACTAAAAATACTCCGCA
CCGCCGAGTTCACGCCCTATGTCGTGTTTATAGCGGCGCCCTCACTGCAG
AACATAGCAGATTACGACGGCAGCCTGGAGCGACTGGCCAAGGAGTCGGA
GATGCTGCGCCAGCTATACGGTCACTTCTTCGATCTGACGATTGTGAACA
ACGATATTAGCGAGACGATTGCCACGCTGGAGACGGCCATCGACCGGGTG
CATACCACCCCGCAGTGGGTGCCCGTATCCTGGCTGTACGCAAGCTTTCT
AGACCAT

BO19876.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
CASK-RD 1776 CG6703-PD 1..1773 17..1789 8865 100 Plus
CASK-RA 1776 CG6703-PA 1..1773 17..1789 8865 100 Plus
CASK-RE 1410 CG6703-PE 16..1407 398..1789 6960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
CASK-RD 4017 CG6703-RD 1320..3093 16..1789 8870 100 Plus
CASK-RA 4112 CG6703-RA 1415..3188 16..1789 8870 100 Plus
CASK-RE 2586 CG6703-RE 271..1662 398..1789 6960 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:17:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21803683..21804065 398..16 1915 100 Minus
3R 32079331 3R 21791960..21792149 584..395 950 100 Minus
3R 32079331 3R 21786686..21786862 1789..1613 885 100 Minus
3R 32079331 3R 21786930..21787106 1612..1436 885 100 Minus
3R 32079331 3R 21791729..21791894 748..583 830 100 Minus
3R 32079331 3R 21789449..21789592 1085..942 720 100 Minus
3R 32079331 3R 21787786..21787911 1328..1203 630 100 Minus
3R 32079331 3R 21787979..21788103 1209..1085 610 99.2 Minus
3R 32079331 3R 21787172..21787280 1437..1329 545 100 Minus
3R 32079331 3R 21789662..21789760 946..848 495 100 Minus
3R 32079331 3R 21791531..21791604 817..744 355 98.6 Minus
Blast to na_te.dros performed on 2014-11-26 15:17:33 has no hits.

BO19876.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:17 Download gff for BO19876.complete
Subject Subject Range Query Range Percent Splice Strand
Caki-RD 1319..3091 17..1791 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:30:31 Download gff for BO19876.complete
Subject Subject Range Query Range Percent Splice Strand
CASK-RA 1416..3188 17..1791 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:10:24 Download gff for BO19876.complete
Subject Subject Range Query Range Percent Splice Strand
CASK-RA 1416..3188 17..1791 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:10:24 Download gff for BO19876.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21803684..21804064 17..397 100   Minus
3R 21791961..21792146 398..583 100 <- Minus
3R 21791729..21791893 584..748 100 <- Minus
3R 21791531..21791599 749..817 100 <- Minus
3R 21790709..21790738 818..847 100 <- Minus
3R 21789662..21789760 848..946 100 <- Minus
3R 21789449..21789587 947..1085 100 <- Minus
3R 21787983..21788102 1086..1205 100 <- Minus
3R 21787786..21787908 1206..1328 100 <- Minus
3R 21787173..21787280 1329..1436 100 <- Minus
3R 21786930..21787105 1437..1612 100 <- Minus
3R 21786682..21786862 1613..1791 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:30:31 Download gff for BO19876.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17629406..17629786 17..397 100   Minus
arm_3R 17617683..17617868 398..583 100 <- Minus
arm_3R 17617451..17617615 584..748 100 <- Minus
arm_3R 17617253..17617321 749..817 100 <- Minus
arm_3R 17616431..17616460 818..847 100 <- Minus
arm_3R 17615384..17615482 848..946 100 <- Minus
arm_3R 17615171..17615309 947..1085 100 <- Minus
arm_3R 17613705..17613824 1086..1205 100 <- Minus
arm_3R 17613508..17613630 1206..1328 100 <- Minus
arm_3R 17612895..17613002 1329..1436 100 <- Minus
arm_3R 17612652..17612827 1437..1612 100 <- Minus
arm_3R 17612404..17612584 1613..1791 98 <- Minus

BO19876.pep Sequence

Translation from 16 to 1807

> BO19876.pep
MCQHHGLTSQSLMSGGSHISLLGSSGSSGMSGSGVGSSGQSVPQCPAAVA
AADAAMMGSNAGGHCRSLSGLSSISIPPPPPALFNPCSSALSLQQAAVTR
WGPRTSCPVHSPFRVRVPNGSICSGHQALLHSHDVVARDVYGEEALRVTP
PPMVPYLNGDELDNVEGGELQHVTRVRLVQFQKNTDEPMGITLKMTEDGR
CIVARIMHGGMIHRQATLHVGDEIREINGQPVQHQSVGQLQRMLREARGS
VTFKIVPSYRSAPPPCELFRIRPAPVLIFVRAQFDYNPLDDELIPCAQAG
ISFQVGDILQIISKDDHHWWQARLDTVGGSAGLIPSPELQEWRIACQTVD
KTKQEQVNCSIFGRKKKQCRDKYLAKHNAIFDTLDVVTYEEVVKVPVGDP
NFQRKTLVLLGAHGVGRRHIKNTLISKYPDKYAYPIPHTTRPAKPEEENG
RSYYFVSHDEMMADIGANEYLEYGTHEDAMYGTKLDTIRRIHTEGKMAIL
DVEPQALKILRTAEFTPYVVFIAAPSLQNIADYDGSLERLAKESEMLRQL
YGHFFDLTIVNNDISETIATLETAIDRVHTTPQWVPVSWLYASFLDH

BO19876.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
CASK-PD 591 CG6703-PD 1..591 1..591 3122 100 Plus
CASK-PA 591 CG6703-PA 1..591 1..591 3122 100 Plus
CASK-PG 609 CG6703-PG 1..609 1..591 3093 97 Plus
CASK-PE 469 CG6703-PE 1..469 122..591 2455 99.1 Plus
CASK-PH 929 CG6703-PH 444..898 127..591 2385 97.8 Plus