Clone BO19877 Report

Search the DGRC for BO19877

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:198
Well:77
Vector:pDNR-Dual
Associated Gene/TranscriptCG32372-RA
Protein status:BO19877.pep: Imported from assembly
Sequenced Size:2485

Clone Sequence Records

BO19877.complete Sequence

2485 bp assembled on 2010-10-20

GenBank Submission: KX795638

> BO19877.complete
GAAGTTATCAGTCGACATGACTTCCCTCGTGTACACCGTCTTTCACCTGG
CCTCGCTGCAATGTTCCGTGCGTCCGGAGATCTCGCCCTGCACCTGCGAA
ACGGGCAAAGCCTGGAATCATGTGGAGCTCTCCTGCGAGAAGTTGGAATC
CTTCAACGCCGTCGTGGACAGCCTGGCCAATAAGCTCAATGCCGACACCA
ATATCGACCTAAAGATCACGCACTCGCAACTCGACGACCTGGAAATGCGC
TCGTTTACGGATATGAACTTCAACTTGTACAAGCTACGGATGCAGTGGAA
CAGTCTAAAATCGCTGCCCGAGGTGCCGTTCCGCGGGTTATCGAATGTCA
CCTACCTAAGCATCGGCGACAACGACCTCGACGAGATCCCGAAGCACGCC
CTGAGCCACATGCCGAGCCTTTTGACTCTGGACATTGGGCGGTGCAAGAT
ACGGGCGGTGCAGCAGGAGGACTTCCGGGGCATACAGCGGGTAACGAATC
TGATTCTGGTGAGCAACATCATTACGCGCCTGGACCGAGGATCCTTTCCC
AAGAGCCTCCTCATCCTGCATCTGGGTAGAAACCAACTGGAGTCGCTGAA
TGGCTCGCTTCACGATCTGCACAACTTGGAGTCTCTGTTCATCAATGCGA
ATAATATCACATCGCTGGATGATGAGCTACCCGATGGAGGGCAGTTGCGC
CTCCTGATGGCTCACAATAATAGGTTGGAACGCCTGCCGGCCAATATGGC
CGGTATGCACAGCCTGGAGACGGTCCACATACACTGCAACCAGCTGAGAT
CCTTCGACCGTGTACTTCGCAATGCCGTCAATCTGTCCGAGGTCATGGCC
GATAACAATGAGCTGGAGTACCTGGCCCAGGATGAATTCGCCTCCTGCTC
CAAGGTGGAGACCCTGCAGATGGGCTGCAATCACATCAAGTCGCTCAACT
CCTCGCTACTGCCCATCCTCAAGCTGAAGAATGCCAACTTCTCGTTCAAC
GACATCGAAGAGTTCTCCATGGCGGAACTGCACGGATTGCGATCGCTGAA
GACACTCCAGCTGTCCAGTAATCGCATCCAACGACTGCTGCCCGATCCCC
GGGGAGTGCAGGAGCTGATGCTTGTCAATCTGGATCTGGATAACAATAGA
ATCGACTCTCTGAATGGAGCTTTGGCTGGCTTGGGCAATCTTCGGATACT
CAATTTGGCTGGAAACCGATTGGAACATCTCCAGGTGGGCGATTTCGATG
GCATGATTCGATTGGACATCCTCGACCTGACCGGGAATCAGCTAGCGGAG
CTCAAGCCCTTGGAAATGACTTTGTTGCCCAGCCTGAAAATCCTTAAGGT
TGCGTACAACAATATCACCAAGCTGGAACAGGACTTCAAGGGACTGCCCG
TGCTTTGCCAGGCCAACTTGACCAATAACCAGATTTCGACCATATCGAGT
GAACTCGTCACCAACACGCGCTGCAAAAATCACAATGTTCCCGGCAAACT
GGAGATACATCTAGATGACAATCCCATAATGTGTGACGTGGGATTGAACG
AGCTGTGTCGATTGATGGCCGTTCAGGAGGCACGAATTCGTGGTCGATCC
CAGTGCTTTGAGAATGACCAGGAGGTGTGCACCGTGCTCCCGATGCTATA
CAATGTGAACCTGCCCATAATGGTGACCAATCTAAAGTTGACGGGCCGCG
AGGTTCCAAAGCCGATGGTTCGGGTGATCGTACCATCGCTGATCAAGGCC
AATAATGAGCTATTACCGCCACTTATTGCCACTCTGGGTAATCCAGTGCT
CATTAGCACCGATTTGGTCAATCCGGTGATATCGCCACTACCACCACCAC
TTCTGCTGGCCACCACAACGCCGCCACCGCCTCTGCCACTTCCTGTGGAA
TCGGAAGTTGAGAAGAATGAGTCTACCACTGCGAATCCAGTGCCAACCAA
TTACACACAGGAGACCACGACAACCACAAGTACCACAACGACGACAACAA
CAACGGAGACCAGTAGTCAGGTGGCTCCCATCGAGATTATTACGACTACA
GCACCCACGACGACTACCACCAGCACCACAACACCGAAACCCAATGAAAC
GCTGCCCGTGATTGTGGAACTCCAGGATCCCAATCCACCGGACACTACAG
TCAATCAAACTGCCCTCGTTCCGCCAGTGGTTCTAGATCCCCTGCAGCAG
GATCTGGAAAGGGAGAGGGAACGCGAAAGGGAGCGAGAACTAGAGCGGGA
TCTGGACCACGAGGCGGTGGCCAAGACCGAGTACGAGACGGTCGAGTACA
TCCCCAATCTGGTGCAGCCTCCAGTGGGCAGTGATGCACTGACGCCGCCT
CCGAGCAAGGCGAATGCGCTGGAGGAGGACTCCGAGTCGGTGCACTCTAA
CTCAGTGCACGCGGAGTATCCCCACGCGGCGCAGAGCCTCCAGATTCCCG
AGGAACCGCCGGAGGAGGCAAGCTTTCTAGACCAT

BO19877.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:15:31
Subject Length Description Subject Range Query Range Score Percent Strand
ltl-RB 2454 CG32372-PB 1..2451 17..2467 12255 100 Plus
ltl-RA 2454 CG32372-PA 1..2451 17..2467 12255 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
ltl-RB 4108 CG32372-RB 689..3139 17..2467 12255 100 Plus
ltl-RA 3622 CG32372-RA 203..2653 17..2467 12255 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7524487..7525495 310..1318 5045 100 Plus
3L 28110227 3L 7526094..7527044 1517..2467 4755 100 Plus
3L 28110227 3L 7519685..7519977 17..309 1465 100 Plus
3L 28110227 3L 7525556..7525755 1318..1517 1000 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:15:30 has no hits.

BO19877.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:13 Download gff for BO19877.complete
Subject Subject Range Query Range Percent Splice Strand
CG32372-RA 198..2648 17..2469 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:30:17 Download gff for BO19877.complete
Subject Subject Range Query Range Percent Splice Strand
ltl-RA 203..2653 17..2469 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:43 Download gff for BO19877.complete
Subject Subject Range Query Range Percent Splice Strand
ltl-RA 203..2653 17..2469 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:43 Download gff for BO19877.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7526095..7527044 1518..2469 99   Plus
3L 7525557..7525755 1319..1517 100 -> Plus
3L 7524487..7525495 310..1318 100 -> Plus
3L 7519685..7519977 17..309 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:30:17 Download gff for BO19877.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7519195..7520144 1518..2469 99   Plus
arm_3L 7518657..7518855 1319..1517 100 -> Plus
arm_3L 7517587..7518595 310..1318 100 -> Plus
arm_3L 7512785..7513077 17..309 100 -> Plus

BO19877.pep Sequence

Translation from 16 to 2485

> BO19877.pep
MTSLVYTVFHLASLQCSVRPEISPCTCETGKAWNHVELSCEKLESFNAVV
DSLANKLNADTNIDLKITHSQLDDLEMRSFTDMNFNLYKLRMQWNSLKSL
PEVPFRGLSNVTYLSIGDNDLDEIPKHALSHMPSLLTLDIGRCKIRAVQQ
EDFRGIQRVTNLILVSNIITRLDRGSFPKSLLILHLGRNQLESLNGSLHD
LHNLESLFINANNITSLDDELPDGGQLRLLMAHNNRLERLPANMAGMHSL
ETVHIHCNQLRSFDRVLRNAVNLSEVMADNNELEYLAQDEFASCSKVETL
QMGCNHIKSLNSSLLPILKLKNANFSFNDIEEFSMAELHGLRSLKTLQLS
SNRIQRLLPDPRGVQELMLVNLDLDNNRIDSLNGALAGLGNLRILNLAGN
RLEHLQVGDFDGMIRLDILDLTGNQLAELKPLEMTLLPSLKILKVAYNNI
TKLEQDFKGLPVLCQANLTNNQISTISSELVTNTRCKNHNVPGKLEIHLD
DNPIMCDVGLNELCRLMAVQEARIRGRSQCFENDQEVCTVLPMLYNVNLP
IMVTNLKLTGREVPKPMVRVIVPSLIKANNELLPPLIATLGNPVLISTDL
VNPVISPLPPPLLLATTTPPPPLPLPVESEVEKNESTTANPVPTNYTQET
TTTTSTTTTTTTTETSSQVAPIEIITTTAPTTTTTSTTTPKPNETLPVIV
ELQDPNPPDTTVNQTALVPPVVLDPLQQDLERERERERERELERDLDHEA
VAKTEYETVEYIPNLVQPPVGSDALTPPPSKANALEEDSESVHSNSVHAE
YPHAAQSLQIPEEPPEEASFLDH

BO19877.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:40:18
Subject Length Description Subject Range Query Range Score Percent Strand
ltl-PB 817 CG32372-PB 1..817 1..817 4194 100 Plus
ltl-PA 817 CG32372-PA 1..817 1..817 4194 100 Plus
lbk-PB 1252 CG8434-PB 296..658 65..419 300 27.2 Plus
conv-PA 1092 CG8561-PA 394..903 65..520 282 25.9 Plus
conv-PB 1092 CG8561-PB 394..903 65..520 282 25.9 Plus
conv-PA 1092 CG8561-PA 253..666 67..477 263 23.5 Plus
lbk-PB 1252 CG8434-PB 290..613 178..498 257 27.9 Plus
conv-PA 1092 CG8561-PA 179..570 90..478 234 22.2 Plus