Clone BO19886 Report

Search the DGRC for BO19886

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:198
Well:86
Vector:pDNR-Dual
Associated Gene/TranscriptCG31708-RA
Protein status:BO19886.pep: Imported from assembly
Sequenced Size:1630

Clone Sequence Records

BO19886.complete Sequence

1630 bp assembled on 2010-10-20

GenBank Submission: KX798349

> BO19886.complete
GAAGTTATCAGTCGACATGTTGCCCCCGTCCTGGCATCTAATTGGGGCCC
TCCTAGTGCTCGCGGCAACAGCGGGGGACTCCACCAACAAGATCATCTTG
CCGCAGATTCTAAACGGTGGCGGTGGCGGCGGGGGCGTCGGAACTGCCCA
GGGCAAACATCCGTCTGGATCCAAGACGGTGGCAACTGGAGTGGTTCCAA
ACTTCGGTGGAGCAGCTGGCAATGGAGCGGGCGGAGGAGGACCTGTGGCT
GGCAGCGGAACCGGAAGCACCGTGGTCGGCAGCAATGGCGTGATTGTGGC
CGGAGGCGGGGCCAATGTGCCGACCTCGAATTTAAACATTGTCGTCGAAG
AACCCGAATTTACTGAATACATCGAAAACGTAACTGTACCTGCTGGACGT
AATGTTAAACTCGGTTGCTCCGTGAAAAATCTGGGCTCATATAAGGTCGC
CTGGATGCACTTCGAGCAGTCCGCCATCCTGACCGTTCACAATCACGTGA
TCACGCGCAATCCGCGCATCAGTGTCACGCACGACAAGCACGACAGGCAC
CGCACGTGGTATTTGCACATAAACAATGTGCACGAGGAGGACCGGGGTCG
ATATATGTGCCAGATCAATACGGTGACGGCCAAAACGCAGTTTGGCTACC
TAAACGTTGTCGTTCCCCCCAACATCGACGACTCACTGAGCTCCAGCGAT
GTGATTGTGCGAGAGGGAGCCAACATTTCGCTGAGATGCCGGGCCAGCGG
TAGTCCCAGACCCATTATCAAATGGAAACGCGACGATAACTCCCGCATAG
CCATCAATAAGAATCACATAGTGAACGAATGGGAGGGCGACACTCTCGAG
ATAACTCGCATTTCCCGACTGGACATGGGCGCCTATCTGTGCATCGCCTC
CAATGGGGTTCCACCCACGGTTTCCAAGCGCATCAAAGTCAGCGTGGACT
TTCCTCCAATGCTGCTTATACCCCATCAGTTGGTTGGTGCTCCCGAAGGT
TTCAACGTCACCATCGAATGCTTCACAGAGGCACATCCCACTTCTCTGAA
CTATTGGACACGTGGCGAGGGACCAATCATACACGATTCGCACAAGTACA
AAGTGGAAGCCACAGTCGGATTGCCAGCTTATAAAACCCATATGAAGTTG
ACCATCATCAATGTGAGCAGTGGCGATGATGGTATTTACAAATGTGTGGC
CAAGAATCCGAGAGGGGAAACGGATGGCATCATACGACTGTACGTTTCAT
ATCCTCCAACCACTGCCTCATCGGGTATATACTCCACGGATACGCATTGG
GGGGAAAATGGGATCAACAATAATTATGCTTATGGTGGCCCCGACTCCAC
GCGATCGATTTATGCGCAGGATAAAAATACGCGATATCAATCGAATTTGA
ACGAAATCGGCTTATCTGAACAAAAATCCTTCCTAGATAAGACGCAGAAT
CCGTTGTTGGCCAATGGCAACGCCAACGAGGCGGATGCGGAATCCAACGG
GGCCCGGGGTCACAACCCTTCGATGGCCATTGCGTGGCTGTTCGTCGTCA
TCGCGACACTGTTGTTAACAATCCGATCTGCGGTTGGTTCTAGCCATAGC
CTAAGTCTATGTGCAAGCTTTCTAGACCAT

BO19886.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG31708-RB 1599 CG31708-PB 1..1596 17..1612 7980 100 Plus
CG31708-RA 1599 CG31708-PA 1..1596 17..1612 7980 100 Plus
CG31708-RC 1539 CG31708-PC 1..1363 17..1379 6815 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG31708-RB 3562 CG31708-RB 693..2288 17..1612 7980 100 Plus
CG31708-RA 3444 CG31708-RA 575..2170 17..1612 7980 100 Plus
CG31708-RC 3384 CG31708-RC 575..1937 17..1379 6815 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:10:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9066080..9066401 338..17 1610 100 Minus
2L 23513712 2L 9052905..9053140 1612..1377 1180 100 Minus
2L 23513712 2L 9060710..9060928 662..444 1095 100 Minus
2L 23513712 2L 9059692..9059851 821..662 800 100 Minus
2L 23513712 2L 9055262..9055412 1101..951 755 100 Minus
2L 23513712 2L 9055020..9055162 1244..1102 715 100 Minus
2L 23513712 2L 9053298..9053430 1376..1244 665 100 Minus
2L 23513712 2L 9059471..9059601 950..820 655 100 Minus
2L 23513712 2L 9062398..9062506 447..339 545 100 Minus
2L 23513712 2L 6391145..6391346 645..444 530 84.2 Minus
2L 23513712 2L 6385903..6385993 950..860 260 85.7 Minus
Blast to na_te.dros performed on 2014-11-26 15:10:14 has no hits.

BO19886.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:47:47 Download gff for BO19886.complete
Subject Subject Range Query Range Percent Splice Strand
CG31708-RB 696..2286 22..1614 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:29:40 Download gff for BO19886.complete
Subject Subject Range Query Range Percent Splice Strand
CG31708-RA 580..2170 22..1614 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:07:47 Download gff for BO19886.complete
Subject Subject Range Query Range Percent Splice Strand
CG31708-RA 580..2170 22..1614 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:07:47 Download gff for BO19886.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9066080..9066396 22..338 100   Minus
2L 9062400..9062506 339..445 100 <- Minus
2L 9060710..9060926 446..662 100 <- Minus
2L 9059692..9059850 663..821 100 <- Minus
2L 9059471..9059599 822..950 100 <- Minus
2L 9055262..9055412 951..1101 100 <- Minus
2L 9055020..9055162 1102..1244 100 <- Minus
2L 9053298..9053429 1245..1376 100 <- Minus
2L 9052903..9053140 1377..1614 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:29:40 Download gff for BO19886.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9066080..9066396 22..338 100   Minus
arm_2L 9062400..9062506 339..445 100 <- Minus
arm_2L 9060710..9060926 446..662 100 <- Minus
arm_2L 9059692..9059850 663..821 100 <- Minus
arm_2L 9059471..9059599 822..950 100 <- Minus
arm_2L 9055262..9055412 951..1101 100 <- Minus
arm_2L 9055020..9055162 1102..1244 100 <- Minus
arm_2L 9053298..9053429 1245..1376 100 <- Minus
arm_2L 9052903..9053140 1377..1614 99 <- Minus

BO19886.pep Sequence

Translation from 16 to 1630

> BO19886.pep
MLPPSWHLIGALLVLAATAGDSTNKIILPQILNGGGGGGGVGTAQGKHPS
GSKTVATGVVPNFGGAAGNGAGGGGPVAGSGTGSTVVGSNGVIVAGGGAN
VPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFE
QSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQI
NTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPI
IKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPP
TVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRG
EGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRG
ETDGIIRLYVSYPPTTASSGIYSTDTHWGENGINNNYAYGGPDSTRSIYA
QDKNTRYQSNLNEIGLSEQKSFLDKTQNPLLANGNANEADAESNGARGHN
PSMAIAWLFVVIATLLLTIRSAVGSSHSLSLCASFLDH

BO19886.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:39:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG31708-PB 532 CG31708-PB 1..532 1..532 2813 100 Plus
CG31708-PA 532 CG31708-PA 1..532 1..532 2813 100 Plus
CG31708-PC 512 CG31708-PC 1..512 1..532 2682 96.2 Plus
CG42368-PA 467 CG42368-PA 15..465 72..521 1320 59 Plus
CG34391-PE 469 CG34391-PE 38..426 107..498 829 45.1 Plus