Clone BO19891 Report

Search the DGRC for BO19891

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:198
Well:91
Vector:pDNR-Dual
Associated Gene/TranscriptCG32473-RA
Protein status:BO19891.pep: Imported from assembly
Sequenced Size:3070

Clone Sequence Records

BO19891.complete Sequence

3070 bp assembled on 2010-10-20

GenBank Submission: KX799653

> BO19891.complete
GAAGTTATCAGTCGACATGGTTGCCTGGCTGACGGTTAAGTCAGTGGCCA
TCTTTTTGGGCCTGGCCTCTACTGCTTTTTGTGTGGCCACGATTGTGCTG
GCCGTTCAGAATGCGGACCTGGAGAACGATCTGCAGGATGCCCTCGATAA
GATCGACGCATTGACGGTGGACACCACGTCCACGTCCTCCACCTCTACCA
GCACTTCCACGACCACCACCACTGCAAATCCCAATGGGCCCACGGATGAC
ACCGAGCCTGGCTCTACCACCACACCTGGCGTAGGAGGTGACACAACCCC
CAGTGCAGGAACATCTCCGGGTGGTGAAACTTCGCCATCATCCAGTACAG
GAAGCACCACCAATCCCATCTATCCGACATTGCCGACAGGACTTCCTGAT
CCTGAAAAGATCGAATGGCGCCTGCCCACGGAACTGACGCCCATCAAGTA
CAAGGTGTACTACCATCCCGACTTGACGACCGGCGCCTGTGAGGGAACCG
TGTCCATTCAGTTCCAGCTGAACGCGATCACCAACCTGATCGTCCTGCAC
GCCAAGGAGCTCAATGTGCACAGCATCAGCATCCTGAACATGATGGCGCG
CATACGCGTGGCCATCGATAGCATCAACTTGGATGAGTCCCGGGAGCTGC
TCCTGATCACGCTAAGAGAGGTCCTCAGTATGAACAAGGCCTACACACTG
TCCGCAAGTTTCGACTGCGATCTGAGCAGTCTGGTGGGCAGCTACATCAG
CAACTACACGAATGCCGATGGAGTAGATAGATCAATCATTTCCACAAAGT
TTGAGCCCACTTATGCCCGCCAAGCATTCCCCTGCTTCGATGAGCCCGCC
CTTAAGGCTCAGTTCACCATAACGGTGGCCCGTCCAAGTGGTGATGAGTA
CCATGTGCTGTCCAACATGCCAGTGGCCAGCGAGTATGTCGATGGCGATA
TCACCGAGGTGACTTTCGCGGAGACCGTACCCATGAGCACCTATCTGGCC
GCCTTTGTGGTGTCTGATTTTCAATACAAGGAAACCACTGTGGAGGGAAC
CAGCATCGCTCTGAAAGTCTATGCGCCACCAGCGCAGGTGGAGAAAACCC
AGTACGCCCTGGACACTGCGGCCGGAGTGATGGCCTACTACATCAACTAT
TTCAATGTTTCGTATGCCCTACCCAAATTGGATCTGGTTGCCATACCCGA
TTTCGTGTCCGGTGCTATGGAAAACTGGGGATTGGTCACGTTCCGGGAGA
CGGCTCTTCTGTACGACGAATCTACCAGTTCCAGCGTGAATAAGCAGCGT
GTGGCCATCGTCGTGGCCCATGAGTTGGCTCACCAGTGGTTCGGAAACCT
GGTAACCATGAACTGGTGGAACGATTTGTGGCTAAACGAGGGTTTCGCAT
CATTCCTTGAGTACAAGGGAGTAAAGCAAATGCATCCGGAATGGGATATG
GACAATCAGTTTGTTATTGAGGAACTGCACCCGGTGCTGACCATTGATGC
CACCTTAGCCTCCCATCCGATTGTCAAGTCCATTGAGAGTCCAGCCGAGA
TCACGGAGTACTTCGATACCATCACCTATTCAAAGGGAGCCGCCTTAGTA
CGCATGCTTGAGAATCTGGTGGGCGAGGAAAAGTTGAGGAACGCCACCAC
CCGCTATTTGGTGCGTCATATCTACAGTACTGCCACCACCGAGGATTACC
TCACCGCAGTCGAGGAGGAGGAGGGCCTGGAATTTGACGTGAAGCAGATC
ATGCAGACCTGGACGGAGCAGATGGGTCTTCCGGTTGTGGAGGTGGAGAA
AAGTGGCAGTACTTATAAGCTCACCCAAAAGCGTTTCCTGGCCAACGAAG
ATGACTACGCAGCCGAAGCTGAAGCATCGTCCTTCAACTACCGTTGGTCG
ATTCCCATTACCTACACGAGCAGCATCAACAGTGAAGTCCAATCACTAAT
ATTCAACCACAATGACAATGAGGCCACCATAACGCTTCCGGAAGAGGCCA
GCTGGATTAAGATTAACACGAATCAAGTGGGCTACTACCGGGTGAACTAC
GGCAGCGAACAGTGGGCGGAACTCATATCGGCCCTGAAGAACTCCCGGGA
AACCTTCAGCACCGCCGATCGCGCTCATCTGCTGAACGATGCCAATACCC
TGGCCGCTGCCGGACAGCTTAACTACTCCGTGGCACTGGATCTGATATCT
TACCTGGAGAGCGAGCAGGACTACGTGCCCTGGAGCGTAGGCACCTCCGC
CCTGGCTACGTTAAGGAACCGCGTATACTACACGGACTTGTACACTAATT
ACACCACCTACGCCCGTAAACTGCTTACGCCCATCGTAGAAAAGGTCACG
TTTACCGTGGCAGCCGATCATCTGGAAAATCGCCTCCGTATTAAGGTGCT
GAGCTCAGCCTGCAGCTTGGGACATGAGAGCTCCTTGCAACAGGCGGTCA
CGCTCTTCAACCAGTGGCTAGCCAGCCCCGAGACCCGGCCCAATCCGGAT
ATCCGAGACGTTGTCTACTACTATGGTCTGCAACAGGTGAACACAGAGGC
TGCCTGGGATCAAGTTTGGAAGCTGTATCTGGACGAGAGTGATGCCCAGG
AAAAGCTGAAGTTGATGAACTGCCTAACCGCCGTGCAGGTGCCATGGCTG
TTGCAGCGTTACATCAACTGGGCCTGGGATGAGAGCAATGTCCGCCGCCA
GGACTACTTCACCCTGCTTGGATATATATCCACCAATCCGGTGGGTCAGA
GTCTTGTGTGGGATTACGTGCGTGAAAACTGGGAGAAGTTGGTGGATCGT
TTCGGCATCAATGAACGCACCTTGGGTCGTCTGATCCCCACGATCACTGC
CCGCTTCTCAACAGAAACCAAGCTGGAAGAGATGCAGCAGTTCTTTGCCA
AATATCCCGAGGCTGGAGCCGGAACTGCGGCCCGTCAACAGGCGTTGGAA
GCGGTGAAGGCAAACATCAAATGGCTAGCGGCCAACAAGGCCCAGGTGGG
CGAATGGTTGGCCAATTACGTTCAACAGTCCAGCGTCACCAACCGCATTC
AGGCAAGCTTTCTAGACCAT

BO19891.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG32473-RA 3039 CG32473-PA 1..3036 17..3052 15180 100 Plus
CG32473-RB 2712 CG32473-PB 436..2709 779..3052 11370 100 Plus
CG32473-RC 3078 CG32473-PC 802..3075 779..3052 11370 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG32473-RA 3273 CG32473-RA 78..3113 17..3052 15180 100 Plus
CG32473-RB 3002 CG32473-RB 569..2842 779..3052 11370 100 Plus
CG32473-RC 3635 CG32473-RC 1202..3475 779..3052 11370 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:14:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13310144..13311109 779..1744 4830 100 Plus
3R 32079331 3R 13311953..13312625 2380..3052 3365 100 Plus
3R 32079331 3R 13311404..13311895 1888..2379 2460 100 Plus
3R 32079331 3R 13302798..13303180 27..409 1915 100 Plus
3R 32079331 3R 13304124..13304496 408..780 1865 100 Plus
3R 32079331 3R 13311174..13311317 1744..1887 720 100 Plus
3R 32079331 3R 13313341..13313573 1377..1620 595 84.8 Plus
3R 32079331 3R 13313710..13313973 1888..2169 545 81.2 Plus
3R 32079331 3R 29247180..29247288 1398..1290 320 86.2 Minus
3R 32079331 3R 13300347..13300431 1314..1398 305 90.6 Plus
3R 32079331 3R 13297841..13298076 2699..2934 280 74.6 Plus
3R 32079331 3R 13295918..13296098 1172..1352 245 75.7 Plus
3R 32079331 3R 29242633..29242712 1398..1319 220 85 Minus
3R 32079331 3R 29236928..29237007 1392..1313 205 83.8 Minus
3R 32079331 3R 29143469..29143569 1292..1392 190 79.2 Plus
Blast to na_te.dros performed on 2014-11-26 15:14:32 has no hits.

BO19891.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:08 Download gff for BO19891.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RA 73..3108 17..3054 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:30:04 Download gff for BO19891.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RA 78..3113 17..3054 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:22 Download gff for BO19891.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RA 78..3113 17..3054 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:22 Download gff for BO19891.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13311953..13312625 2380..3054 99   Plus
3R 13311404..13311895 1888..2379 100 -> Plus
3R 13311174..13311317 1744..1887 100 -> Plus
3R 13310146..13311108 781..1743 100 -> Plus
3R 13304126..13304496 410..780 100 -> Plus
3R 13302798..13303180 27..409 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:30:04 Download gff for BO19891.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9137675..9138347 2380..3054 99   Plus
arm_3R 9137126..9137617 1888..2379 100 -> Plus
arm_3R 9136896..9137039 1744..1887 100 -> Plus
arm_3R 9135868..9136830 781..1743 100 -> Plus
arm_3R 9129848..9130218 410..780 100 -> Plus
arm_3R 9128520..9128902 27..409 100 -> Plus

BO19891.pep Sequence

Translation from 16 to 3070

> BO19891.pep
MVAWLTVKSVAIFLGLASTAFCVATIVLAVQNADLENDLQDALDKIDALT
VDTTSTSSTSTSTSTTTTTANPNGPTDDTEPGSTTTPGVGGDTTPSAGTS
PGGETSPSSSTGSTTNPIYPTLPTGLPDPEKIEWRLPTELTPIKYKVYYH
PDLTTGACEGTVSIQFQLNAITNLIVLHAKELNVHSISILNMMARIRVAI
DSINLDESRELLLITLREVLSMNKAYTLSASFDCDLSSLVGSYISNYTNA
DGVDRSIISTKFEPTYARQAFPCFDEPALKAQFTITVARPSGDEYHVLSN
MPVASEYVDGDITEVTFAETVPMSTYLAAFVVSDFQYKETTVEGTSIALK
VYAPPAQVEKTQYALDTAAGVMAYYINYFNVSYALPKLDLVAIPDFVSGA
MENWGLVTFRETALLYDESTSSSVNKQRVAIVVAHELAHQWFGNLVTMNW
WNDLWLNEGFASFLEYKGVKQMHPEWDMDNQFVIEELHPVLTIDATLASH
PIVKSIESPAEITEYFDTITYSKGAALVRMLENLVGEEKLRNATTRYLVR
HIYSTATTEDYLTAVEEEEGLEFDVKQIMQTWTEQMGLPVVEVEKSGSTY
KLTQKRFLANEDDYAAEAEASSFNYRWSIPITYTSSINSEVQSLIFNHND
NEATITLPEEASWIKINTNQVGYYRVNYGSEQWAELISALKNSRETFSTA
DRAHLLNDANTLAAAGQLNYSVALDLISYLESEQDYVPWSVGTSALATLR
NRVYYTDLYTNYTTYARKLLTPIVEKVTFTVAADHLENRLRIKVLSSACS
LGHESSLQQAVTLFNQWLASPETRPNPDIRDVVYYYGLQQVNTEAAWDQV
WKLYLDESDAQEKLKLMNCLTAVQVPWLLQRYINWAWDESNVRRQDYFTL
LGYISTNPVGQSLVWDYVRENWEKLVDRFGINERTLGRLIPTITARFSTE
TKLEEMQQFFAKYPEAGAGTAARQQALEAVKANIKWLAANKAQVGEWLAN
YVQQSSVTNRIQASFLDH

BO19891.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG32473-PA 1012 CG32473-PA 1..1012 1..1012 5227 100 Plus
CG32473-PC 1025 CG32473-PC 115..1025 107..1012 4023 86.9 Plus
CG32473-PB 903 CG32473-PB 16..903 130..1012 4014 88.7 Plus
CG8773-PB 994 CG8773-PB 3..989 5..998 2805 55.1 Plus
CG8774-PB 885 CG8774-PB 8..885 133..1011 2238 49 Plus