Clone BO19892 Report

Search the DGRC for BO19892

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:198
Well:92
Vector:pDNR-Dual
Associated Gene/TranscriptSAK-RA
Protein status:BO19892.pep: Imported from assembly
Sequenced Size:2341

Clone Sequence Records

BO19892.complete Sequence

2341 bp assembled on 2010-10-20

GenBank Submission: KX795210

> BO19892.complete
GAAGTTATCAGTCGACATGTTATCCAATCGGGCGTTTGGAGAAACAATTG
AGGACTATGAAGTACAGCACTTGCTGGGTAAAGGTGGTTTTGCGACCGTC
TACAAGGCGCGGTGCCTGCACACTCACCAGGATGTGGCCATAAAGATGAT
CGATAAAAAACTAATCCAGGGCACTGGACTCACTAACCGCGTTCGCCAGG
AAGTGGAAATCCACTCCCGCCTGAAGCATCCCTCTGTGCTTCAGCTGTAC
ACTTTCTTTCAGGACGCCAACTATGTGTATTTGGTGCTCGAGCTGGCCCA
TAATGGGGAGCTTCATCGCTATATGAACCACATCGCCAGACCCTTCACAG
AGACGGAAGCTGCTTCCATTCTGAAGCAGGTGGTGGCGGGACTTTTGTAC
CTGCACTCCCACAACATCATGCACCGCGACATTTCGCTGTCCAACCTACT
GCTTAGCAGGGAAATGCACGTCAAGATAGCCGATTTTGGACTGGCCACCC
AATTAAAGCGACCTGATGAGCGCCATATGACCATGTGTGGAACTCCGAAC
TATATTTCGCCTGAGGTGGTATCGCGAACGTCTCACGGACTGCCCGCGGA
CGTCTGGAGCGTTGGATGCATGCTGTACACCCTGCTGGTTGGACGCCCGC
CCTTCGAAACCGATGCAGTGCAGTCAACCCTTAACAAAGTTGTGATGTCC
GAGTACATTATGCCGGCTCACTTGTCTTACGAGGCGCAGGACCTGATAAA
CAAATTATTAAAAAAGCTCCCGCACGAACGAATTACCCTGGAGGCTGTTC
TCTGCCATCCCTTTATGTTGAAATGCTCAAATGGTGGACACTCTGCGCCG
GGAGCGTTGAATGTGTTCAGCCAGAGTATGGAAAGTGGCGATAGTGGAAT
CATAACATTTGCTAGCAGTGACTCCCGGAATTCCCAGCAAATTCGATCTG
TGGAAAACTCAGGACCACAACAAGTGCTTCCTCAAATACGGGAGGAATTT
AAGCAAGTCCATCATAAATTGCCTTATGAACAGACAGGTTTATTTGGGCA
AGCTTCAACTGGCTTGGCAGAGCCAAATTGGCCAGGAGCTGCTAAGTCCT
CAGCGTTCTGCATGGAGGCGGGCAATGTACCCAATTCCAAACAGGCATCT
CTTAAGGAAGATCGCATTTCGGTGCCACCATTGAATACTAAAAGACTGCT
TCCGACGCGTTATAAGACGAAGAATGCTATAATGAGTATTTTGCGCAATG
GAGAGGTAGTTCTCGAGTTTCTTAAGTTTCGGCCAACCTATAATGAAGAT
CGCATTAATGATATTTGTCGCATATCGGATGACGGACAGCGAATCATAAT
TTATCAACCAGATCCTGGGCGTGGCTTACCAGTGAGAGAGCAGCCACCAG
ATCTTCAAATACCAAGCGGAGATTGTGTATATAACTACGATAATTTGCCC
AGCAAGCACTGGAAAAAATACATATACGGAGCTCGATTTGTAGGGCTGGT
AAAAAGCAAAACACCAAAAGTCACATACTTCAGTACTCTAGGCAAATGCC
AATTGATGGAGACAATGACCGACTTTGAGATTCGTTTCTACTCGGGAGCT
AAGCTACTAAAGACGCCGTCCGAGGGGCTAAAGGTCTACGATCGAAATGG
AATGTTGCTCTCGGATTATTCCTGTTCGGAGTCACGATCCCTAATAGAGC
ACGGAAACGAGTGTTTCACCCACTGTGTCAACATCAGTAATGCCTTGGAA
GTAGCTCAGACGAAAGATAATTCGTGTTTTCCAGTCACAATCGGACGAAG
ACCTATAACAGATGTACAACCCGCTCAGAGATTGGATGGCCTACGAGATA
CCACCAATATTGCGTTTTCCACACCAAAATCTAATCAGGGCTCAATAAAC
TTTTCCTTAAGCACTATTTCGTCGACTCGAAATACTTCAGATTTTGGAAC
CAACTGCTCTAGGTCCAACATGCTAGCCGCCCATCAAAATATACCCATCA
AACGCATAAACGTTCCTGAAATCGGAATAGCTACTGAGCTCTCCCATGGA
GTTGTCCAAGTGCAATTTTATGATGGATCCGTGGTCTCTGTTATTCCGAG
CATGCAAGGTGGTGGTATAACCTATACCCAACCCAACGGAACTTCAACCC
ACTTCGGCAAGGGCGACGACTTGCCATTCCCGGTCAGAGATAGAGTCGGT
CAGATACCAAACATTCAGTTAAAGTTGAAGACAGCTCCATTGCTGGGAAG
CGGCAGGAAAACTGACTACAACAATGCAATGACTCCCAAAACGACAACGC
CTTATTATAATCGCATGCTTCTTGCAAGCTTTCTAGACCAT

BO19892.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:13:40
Subject Length Description Subject Range Query Range Score Percent Strand
SAK-RA 2310 CG7186-PA 1..2307 17..2323 11535 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
SAK-RA 3371 CG7186-RA 137..2443 17..2323 11535 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:13:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21514737..21515508 919..148 3860 100 Minus
3L 28110227 3L 21513642..21514160 1889..1371 2595 100 Minus
3L 28110227 3L 21514220..21514673 1371..918 2270 100 Minus
3L 28110227 3L 21513069..21513355 2323..2037 1435 100 Minus
3L 28110227 3L 21513436..21513588 2038..1886 765 100 Minus
3L 28110227 3L 21515561..21515658 148..51 490 100 Minus
3L 28110227 3L 21515715..21515751 53..17 185 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:13:39 has no hits.

BO19892.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:07 Download gff for BO19892.complete
Subject Subject Range Query Range Percent Splice Strand
SAK-RA 139..2440 22..2325 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:29:59 Download gff for BO19892.complete
Subject Subject Range Query Range Percent Splice Strand
SAK-RA 142..2443 22..2325 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:03 Download gff for BO19892.complete
Subject Subject Range Query Range Percent Splice Strand
SAK-RA 142..2443 22..2325 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:03 Download gff for BO19892.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21515716..21515746 22..52 100   Minus
3L 21515561..21515656 53..148 100 <- Minus
3L 21514739..21515507 149..917 100 <- Minus
3L 21514220..21514673 918..1371 100 <- Minus
3L 21513643..21514159 1372..1888 100 <- Minus
3L 21513436..21513585 1889..2038 100 <- Minus
3L 21513067..21513353 2039..2325 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:29:59 Download gff for BO19892.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21508816..21508846 22..52 100   Minus
arm_3L 21508661..21508756 53..148 100 <- Minus
arm_3L 21507839..21508607 149..917 100 <- Minus
arm_3L 21507320..21507773 918..1371 100 <- Minus
arm_3L 21506743..21507259 1372..1888 100 <- Minus
arm_3L 21506536..21506685 1889..2038 100 <- Minus
arm_3L 21506167..21506453 2039..2325 99 <- Minus

BO19892.pep Sequence

Translation from 16 to 2341

> BO19892.pep
MLSNRAFGETIEDYEVQHLLGKGGFATVYKARCLHTHQDVAIKMIDKKLI
QGTGLTNRVRQEVEIHSRLKHPSVLQLYTFFQDANYVYLVLELAHNGELH
RYMNHIARPFTETEAASILKQVVAGLLYLHSHNIMHRDISLSNLLLSREM
HVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLPADVWSVG
CMLYTLLVGRPPFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKK
LPHERITLEAVLCHPFMLKCSNGGHSAPGALNVFSQSMESGDSGIITFAS
SDSRNSQQIRSVENSGPQQVLPQIREEFKQVHHKLPYEQTGLFGQASTGL
AEPNWPGAAKSSAFCMEAGNVPNSKQASLKEDRISVPPLNTKRLLPTRYK
TKNAIMSILRNGEVVLEFLKFRPTYNEDRINDICRISDDGQRIIIYQPDP
GRGLPVREQPPDLQIPSGDCVYNYDNLPSKHWKKYIYGARFVGLVKSKTP
KVTYFSTLGKCQLMETMTDFEIRFYSGAKLLKTPSEGLKVYDRNGMLLSD
YSCSESRSLIEHGNECFTHCVNISNALEVAQTKDNSCFPVTIGRRPITDV
QPAQRLDGLRDTTNIAFSTPKSNQGSINFSLSTISSTRNTSDFGTNCSRS
NMLAAHQNIPIKRINVPEIGIATELSHGVVQVQFYDGSVVSVIPSMQGGG
ITYTQPNGTSTHFGKGDDLPFPVRDRVGQIPNIQLKLKTAPLLGSGRKTD
YNNAMTPKTTTPYYNRMLLASFLDH

BO19892.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
SAK-PA 769 CG7186-PA 1..769 1..769 4029 100 Plus
polo-PB 576 CG12306-PB 25..277 14..267 522 38.9 Plus
polo-PA 576 CG12306-PA 25..277 14..267 522 38.9 Plus
aurA-PA 411 CG3068-PA 151..407 11..268 480 38.3 Plus
aurB-PA 329 CG6620-PA 36..302 1..264 470 38.2 Plus