Clone BO19895 Report

Search the DGRC for BO19895

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:198
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptIswi-RA
Protein status:BO19895.pep: Imported from assembly
Sequenced Size:3115

Clone Sequence Records

BO19895.complete Sequence

3115 bp assembled on 2010-10-20

GenBank Submission: KX800149

> BO19895.complete
GAAGTTATCAGTCGACATGTCCAAAACAGATACAGCTGCCGTGGAGGCAA
CCGAAGAGAACTCGAACGAGACGACTTCAGATGCGGCCACCAGTTCATCC
GGTGAAAAGGAGGCTGAGTTCGACAACAAAATCGAGGCTGATCGCAGTAG
GCGCTTTGATTTCCTGCTAAAGCAGACGGAGATATTCACCCACTTCATGA
CTAACAGCGCTAAGAGTCCCACGAAGCCTAAGGGTAGACCCAAGAAGATC
AAAGACAAGGACAAGGAAAAGGATGTGGCCGATCATCGTCATCGCAAGAC
AGAGCAGGAGGAGGATGAGGAGTTGCTGGCGGAAGACTCGGCCACCAAGG
AGATCTTTCGCTTCGATGCCTCACCCGCCTACATCAAAAGTGGAGAGATG
CGTGACTACCAGATTCGCGGTCTTAACTGGATGATTTCGCTTTACGAAAA
TGGTATCAATGGAATTCTGGCCGATGAAATGGGTCTAGGAAAGACCCTGC
AGACCATATCTCTGCTGGGTTACCTCAAGCATTTCAAAAATCAAGCTGGA
CCACACATCGTCATCGTGCCAAAGTCAACGCTTCAGAATTGGGTAAATGA
GTTTAAAAAGTGGTGTCCTTCCCTCAGAGCCGTCTGCCTTATTGGTGACC
AGGACACCCGTAACACCTTCATTAGAGATGTGCTCATGCCTGGCGAGTGG
GACGTTTGCGTGACCTCCTATGAGATGTGTATCCGCGAGAAGTCTGTATT
CAAGAAGTTCAACTGGCGCTATTTGGTCATCGACGAGGCGCATCGTATCA
AGAACGAGAAGTCGAAGCTGTCGGAGATTCTGCGAGAGTTTAAGACCGCT
AATCGTCTACTTATCACGGGTACTCCGCTGCAGAATAACCTCCACGAGCT
GTGGGCCCTGCTTAATTTCCTGCTGCCCGATGTGTTTAATTCGTCAGAGG
ATTTTGACGAATGGTTCAACACGAACACCTGCCTGGGTGACGATGCATTG
ATTACGCGTTTGCATGCCGTGCTGAAACCTTTCCTGCTCCGTCGTCTAAA
GGCCGAAGTGGAGAAGCGTCTGAAGCCGAAGAAGGAGATGAAAATATTTG
TGGGTCTATCCAAGATGCAACGCGACTGGTACACCAAGGTGCTGCTTAAG
GACATTGATGTAGTGAACGGTGCTGGCAAAGTGGAGAAGATGCGACTGCA
GAACATCCTTATGCAGCTCCGCAAGTGCACCAACCACCCATATTTGTTTG
ATGGCGCCGAGCCCGGTCCGCCATACACCACGGACACGCATTTGGTGTAT
AACTCCGGAAAGATGGCTATTCTGGACAAGCTGCTGCCCAAGCTCCAAGA
GCAGGGATCGCGTGTGTTGATTTTCTCACAAATGACGAGGATGTTGGATA
TCCTCGAGGACTACTGTCACTGGCGCAACTACAACTATTGCCGCCTGGAT
GGTCAGACGCCGCACGAAGATCGTAACAGGCAGATTCAGGAATTTAACAT
GGACAACAGCGCCAAGTTTCTCTTCATGTTGTCCACCCGAGCCGGTGGTT
TGGGTATCAATTTGGCTACCGCTGATGTTGTCATCATTTACGACTCGGAT
TGGAATCCTCAAATGGATTTGCAAGCTATGGATCGTGCTCATCGTATTGG
TCAAAAGAAGCAAGTGCGCGTTTTCCGGCTGATCACCGAAAGTACAGTGG
AGGAGAAGATCGTGGAGAGAGCAGAGGTCAAGCTCCGTCTGGACAAGATG
GTCATCCAGGGGGGCAGATTGGTTGACAACCGCTCCAATCAGTTGAACAA
GGATGAAATGCTTAATATAATCCGTTTTGGAGCTAACCAAGTGTTCAGCT
CTAAGGAGACAGACATTACCGATGAGGACATCGATGTTATTTTGGAGCGC
GGTGAGGCCAAGACGGCCGAGCAAAAGGCAGCACTGGACAGTCTGGGCGA
GAGTTCGCTGCGGACGTTCACAATGGACACAAACGGCGAGGCAGGAACTT
CTTCCGTATATCAATTCGAGGGTGAGGATTGGCGCGAGAAGCAAAAGCTA
AATGCGCTGGGCAACTGGATCGAGCCACCGAAGCGTGAACGCAAAGCCAA
CTATGCTGTGGATGCCTATTTCCGCGAGGCTCTCCGTGTCTCCGAACCCA
AGGCACCGAAGGCTCCCCGCCCACCCAAGCAGCCTATCGTTCAGGACTTT
CAGTTCTTCCCACCCCGTCTGTTTGAGCTGCTCGACCAGGAAATCTACTA
TTTCCGCAAGACTGTTGGTTACAAGGTGCCCAAGAACACGGAACTAGGAT
CGGATGCCACCAAAGTGCAGCGCGAGGAGCAGCGCAAGATCGATGAGGCA
GAGCCGCTTACCGAGGAAGAGATCCAGGAGAAGGAGAATCTACTCTCACA
GGGTTTCACTGCCTGGACCAAGCGCGATTTCAACCAGTTCATCAAGGCTA
ACGAAAAGTACGGTCGGGATGATATTGACAACATTGCCAAGGACGTGGAG
GGCAAGACTCCGGAGGAGGTTATCGAGTACAACGCCGTGTTTTGGGAGCG
ATGCACTGAGTTGCAGGATATTGAGCGAATAATGGGACAGATTGAGCGTG
GAGAGGGCAAGATTCAACGGCGATTGTCTATTAAGAAGGCTTTGGATCAA
AAGATGTCGCGGTATCGCGCCCCCTTCCATCAGTTGCGGCTGCAATATGG
TAATAACAAGGGCAAGAATTACACTGAAATAGAGGATCGCTTTCTGGTAT
GCATGCTTCACAAGTTGGGCTTTGACAAGGAGAATGTCTACGAAGAGCTG
CGAGCGGCTATAAGAGCTTCTCCGCAATTCCGCTTTGACTGGTTCATCAA
ATCTAGAACCGCTTTGGAGCTACAGCGTCGCTGCAACACGTTGATTACCC
TTATTGAACGTGAAAACATTGAGCTGGAAGAGAAAGAACGCGCCGAGAAA
AAGAAAAAGGCACCAAAGGGCAGCGTGTCCGCTGGAAGTGGAAGTGCCAG
CTCGAACACTCCAGCACCCGCGCCCCAACCGAAGGCCAGTCAAAAGCGGA
AGAGCGAGGTGGTGGCAACCAGTTCCAACTCGAAAAAGAAGAAGAAGGCA
AGCTTTCTAGACCAT

BO19895.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
Iswi-RC 3084 CG8625-PC 1..3081 17..3097 15405 100 Plus
Iswi-RB 3084 CG8625-PB 1..3081 17..3097 15405 100 Plus
Iswi-RA 3084 CG8625-PA 1..3081 17..3097 15405 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
Iswi-RC 3585 CG8625-RC 211..3291 17..3097 15405 100 Plus
Iswi-RB 3541 CG8625-RB 167..3247 17..3097 15405 100 Plus
Iswi-RA 3647 CG8625-RA 273..3353 17..3097 15405 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12637655..12639770 538..2653 10580 100 Plus
2R 25286936 2R 12640050..12640334 2813..3097 1425 100 Plus
2R 25286936 2R 12637339..12637593 283..537 1275 100 Plus
2R 25286936 2R 12637053..12637271 64..282 1095 100 Plus
2R 25286936 2R 12639828..12639990 2652..2814 815 100 Plus
2R 25286936 2R 12636943..12636990 17..64 240 100 Plus
3L 28110227 3L 15971715..15971834 1654..1535 225 79.2 Minus
3L 28110227 3L 15972580..15972650 928..858 190 84.5 Minus
Blast to na_te.dros performed on 2014-11-26 15:09:32 has no hits.

BO19895.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:47:44 Download gff for BO19895.complete
Subject Subject Range Query Range Percent Splice Strand
Iswi-RC 161..3241 17..3099 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:29:34 Download gff for BO19895.complete
Subject Subject Range Query Range Percent Splice Strand
Iswi-RA 273..3353 17..3099 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:07:33 Download gff for BO19895.complete
Subject Subject Range Query Range Percent Splice Strand
Iswi-RA 273..3353 17..3099 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:07:33 Download gff for BO19895.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12640052..12640334 2815..3099 99   Plus
2R 12639830..12639990 2654..2814 100 -> Plus
2R 12637655..12639770 538..2653 100 -> Plus
2R 12637339..12637593 283..537 100 -> Plus
2R 12637054..12637271 65..282 100 -> Plus
2R 12636943..12636990 17..64 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:29:34 Download gff for BO19895.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8527557..8527839 2815..3099 99   Plus
arm_2R 8527335..8527495 2654..2814 100 -> Plus
arm_2R 8525160..8527275 538..2653 100 -> Plus
arm_2R 8524844..8525098 283..537 100 -> Plus
arm_2R 8524559..8524776 65..282 100 -> Plus
arm_2R 8524448..8524495 17..64 100 -> Plus

BO19895.pep Sequence

Translation from 16 to 3115

> BO19895.pep
MSKTDTAAVEATEENSNETTSDAATSSSGEKEAEFDNKIEADRSRRFDFL
LKQTEIFTHFMTNSAKSPTKPKGRPKKIKDKDKEKDVADHRHRKTEQEED
EELLAEDSATKEIFRFDASPAYIKSGEMRDYQIRGLNWMISLYENGINGI
LADEMGLGKTLQTISLLGYLKHFKNQAGPHIVIVPKSTLQNWVNEFKKWC
PSLRAVCLIGDQDTRNTFIRDVLMPGEWDVCVTSYEMCIREKSVFKKFNW
RYLVIDEAHRIKNEKSKLSEILREFKTANRLLITGTPLQNNLHELWALLN
FLLPDVFNSSEDFDEWFNTNTCLGDDALITRLHAVLKPFLLRRLKAEVEK
RLKPKKEMKIFVGLSKMQRDWYTKVLLKDIDVVNGAGKVEKMRLQNILMQ
LRKCTNHPYLFDGAEPGPPYTTDTHLVYNSGKMAILDKLLPKLQEQGSRV
LIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAK
FLFMLSTRAGGLGINLATADVVIIYDSDWNPQMDLQAMDRAHRIGQKKQV
RVFRLITESTVEEKIVERAEVKLRLDKMVIQGGRLVDNRSNQLNKDEMLN
IIRFGANQVFSSKETDITDEDIDVILERGEAKTAEQKAALDSLGESSLRT
FTMDTNGEAGTSSVYQFEGEDWREKQKLNALGNWIEPPKRERKANYAVDA
YFREALRVSEPKAPKAPRPPKQPIVQDFQFFPPRLFELLDQEIYYFRKTV
GYKVPKNTELGSDATKVQREEQRKIDEAEPLTEEEIQEKENLLSQGFTAW
TKRDFNQFIKANEKYGRDDIDNIAKDVEGKTPEEVIEYNAVFWERCTELQ
DIERIMGQIERGEGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGNNKGK
NYTEIEDRFLVCMLHKLGFDKENVYEELRAAIRASPQFRFDWFIKSRTAL
ELQRRCNTLITLIERENIELEEKERAEKKKKAPKGSVSAGSGSASSNTPA
PAPQPKASQKRKSEVVATSSNSKKKKKASFLDH

BO19895.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
Iswi-PC 1027 CG8625-PC 1..1027 1..1027 5339 100 Plus
Iswi-PB 1027 CG8625-PB 1..1027 1..1027 5339 100 Plus
Iswi-PA 1027 CG8625-PA 1..1027 1..1027 5339 100 Plus
brm-PD 1634 CG5942-PD 699..1292 74..630 1147 41.6 Plus
brm-PC 1634 CG5942-PC 699..1292 74..630 1147 41.6 Plus