Clone BO19952 Report

Search the DGRC for BO19952

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:199
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptCG31300-RA
Protein status:BO19952.pep: Imported from assembly
Sequenced Size:1300

Clone Sequence Records

BO19952.complete Sequence

1300 bp assembled on 2010-10-13

GenBank Submission: KX796600

> BO19952.complete
GAAGTTATCAGTCGACATGACTGACAAGTTAGATGCGGAACAATTTAACG
ACGACGAACTAGAGGCACCTGCTTGGCTGAATCGTCAATTTATAGAGGAA
ATTCTGAGCGCGTACGAAGATTCCCCGGAACTAAAAGTTGTCGATCTTAA
AATCACACCCGCAAGTGCCCAGGGAGATCACTATGCCAGCGTTATGTTCC
GAACAACTGCAGAGTGTACCACCGCGAAGGGAAAGTTCAGTAGGCCACTA
ATCATCAAGGCGATGCCCGAGCAGGATGGACACAAGAAGGATATGCTCAG
CGAATCGCATCTATTCGAAACCGAGATCGGAATGTACTGCCAGGTTCTTC
CGGAATTCGAGAGAATTCTGCGGGAATCCGGAGACGATACAAAGCTATTT
GTTCCCTGCATTTACCATAGCCTGGAGCCGCGTAAGGTGATGATATTTGA
GGACCTTGTGCCCCAGGGATATTATGTCATTCGAGACCGTCCGGTTGCTC
AGGAAGAACTCAAAACAGCCTTTGCTAAACTGGCCAAATGGCATGCAATT
AGCATGAAATACATTAAGGAGCAACCTGACTTCCTAAAGGAGTTTAAGTA
TGGCCTCTTCGAGATGCCCACTGTAAAGACCGACCCTTTTATTACAACTG
GCATGCAGAGCTTCATTGAAATGCTGGACAGATTACCAGAGCTAAGAAAG
TATAAGCCTCATTTCGAAAAGATAAAAGATAAGTACATGCAACGACTACA
AGCTGTGATGAAGGAATACCATGAAAATCGAAAGAGTGATGCCTTCTATG
TCCTCTGTCATGGTGACTTCCATCTTCGCAATATGATGTTCAAGAACAAC
AAGGGGACGGGAGCCCACGAGGATACCATGCTGGTGGATTTCCAGATTAG
CAACCTTTGTCCCATCACAATTGATCTCACATATTCCATCTATATGCTGA
TGGAGCCGGAACAACGCAGAGAAATGGGAAAGGACTTGATTAATCACTAC
TTAACCGTTTTGGTTGCCACCCTCAAGAGCATTGGATACCCAGGTGAACT
GCCAACCCAAGCGAAACTCTGGGATGAAATCCATAAGAACAAGTATTATG
ATTTCTTTTTGTTGAGCACTTTTCTGCCCTTGATTTTGGCCATCAAATCG
AAGAGTTTTAAAGTGAACGACCTTATACAGGATCCGGAAACCCGCCAAAA
AACCTACTTTTTGGATACATATGTTAAAGATGTTTCCAAACTATTGCCGA
AATTCGAGCAACTTGGCTACTTTAAATGTCTAGCAAGCTTTCTAGACCAT

BO19952.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG31300-RA 1269 CG31300-PA 1..1266 17..1282 6330 100 Plus
CG31104-RA 1263 CG31104-PA 31..1103 53..1125 1525 76.1 Plus
CG11893-RA 1251 CG11893-PA 15..722 31..738 810 74.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG31300-RA 1474 CG31300-RA 72..1337 17..1282 6330 100 Plus
CG31104-RA 1382 CG31104-RA 91..1163 53..1125 1525 76.1 Plus
CG11893-RA 1415 CG11893-RA 53..760 31..738 810 74.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:58:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25283691..25284245 17..571 2775 100 Plus
3R 32079331 3R 25284305..25284835 570..1100 2655 100 Plus
3R 32079331 3R 25284905..25285087 1100..1282 915 100 Plus
3R 32079331 3R 25286135..25286665 570..1100 810 76.8 Plus
3R 32079331 3R 25289941..25290648 31..738 810 74.3 Plus
3R 32079331 3R 25285563..25285978 53..468 685 77.6 Plus
3R 32079331 3R 25304361..25304650 164..453 310 73.8 Plus
3R 32079331 3R 25287638..25287958 170..490 300 72.9 Plus
Blast to na_te.dros performed on 2014-11-26 14:58:29 has no hits.

BO19952.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-13 10:03:33 Download gff for BO19952.complete
Subject Subject Range Query Range Percent Splice Strand
CG31300-RA 70..1335 17..1284 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:27:51 Download gff for BO19952.complete
Subject Subject Range Query Range Percent Splice Strand
CG31300-RA 72..1337 17..1284 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:03:54 Download gff for BO19952.complete
Subject Subject Range Query Range Percent Splice Strand
CG31300-RA 72..1337 17..1284 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:03:54 Download gff for BO19952.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25284906..25285087 1101..1284 98   Plus
3R 25284307..25284835 572..1100 100 -> Plus
3R 25283691..25284245 17..571 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:27:51 Download gff for BO19952.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21110628..21110809 1101..1284 98   Plus
arm_3R 21110029..21110557 572..1100 100 -> Plus
arm_3R 21109413..21109967 17..571 100 -> Plus

BO19952.pep Sequence

Translation from 16 to 1300

> BO19952.pep
MTDKLDAEQFNDDELEAPAWLNRQFIEEILSAYEDSPELKVVDLKITPAS
AQGDHYASVMFRTTAECTTAKGKFSRPLIIKAMPEQDGHKKDMLSESHLF
ETEIGMYCQVLPEFERILRESGDDTKLFVPCIYHSLEPRKVMIFEDLVPQ
GYYVIRDRPVAQEELKTAFAKLAKWHAISMKYIKEQPDFLKEFKYGLFEM
PTVKTDPFITTGMQSFIEMLDRLPELRKYKPHFEKIKDKYMQRLQAVMKE
YHENRKSDAFYVLCHGDFHLRNMMFKNNKGTGAHEDTMLVDFQISNLCPI
TIDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSIGYPGELPTQAK
LWDEIHKNKYYDFFLLSTFLPLILAIKSKSFKVNDLIQDPETRQKTYFLD
TYVKDVSKLLPKFEQLGYFKCLASFLDH

BO19952.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG31300-PA 422 CG31300-PA 1..422 1..422 2226 100 Plus
CG31104-PA 420 CG31104-PA 7..420 9..422 1647 72.2 Plus
CG11893-PA 416 CG11893-PA 1..416 1..422 1587 67.8 Plus
CG13658-PB 422 CG13658-PB 1..422 1..422 1440 62.6 Plus
CG31436-PA 420 CG31436-PA 9..416 9..417 1233 55.7 Plus