Clone BO19973 Report

Search the DGRC for BO19973

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:199
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptCG8111-RA
Protein status:BO19973.pep: Imported from assembly
Sequenced Size:1162

Clone Sequence Records

BO19973.complete Sequence

1162 bp assembled on 2010-10-13

GenBank Submission: KX795507

> BO19973.complete
GAAGTTATCAGTCGACATGGCATCTCTGAGCGAAACACTTCGTAGCCACT
GGCCCATCGCTTTGTTCGGTGTGATCCTCTTCGTGGCTGGGGGCACGGAG
CTCTACTGGAACGAGGGACGAGCCGTGCACAATATGATGGCGCTGGACGA
GGCACACGCCGACATCTACTCGGTGCGCTTCACGGAGGAGGAACAGGAGG
TGGGCCTCGAGGGCAGAATCGTTCACCTATCCGGACCCATTCTCGTGGGC
GAACCGCTCACCGAACCCGACTACAACATTCAGTTGCTGGCGGTGAAGCT
CCGGCGACGCGTCCAAATGTACCAGTGGGTCGAGGAGGCGGTCGAGCACA
ACTACGGCGACAGCGTGGGAACGACGCATTCGGACTCCCGCACCTACTAT
TACACGCGGGAATGGCGTGATAAGATCGTGGACTCGCGAAACTTCTACAA
CCGCCACGGACACACGAATCCCAGTCACTTTCCCATCGAAAGCCACGTTC
AGGTGGCGGATGCCGTCTTCATTGGACGCTATGAACTGGGTGCGGAGGTG
AAGGAGAAGTTTAACAACTACCAGGAGCTCACTTCGGACATTCGGCCAGA
GGATAGTGGCGTCAAGCTGCATCTGGGCATATATTATCACACCAATGATG
TGTTCAATCCGGAGGTGGGTGACCTGCGCCTGCTCTTCAGCTTCGCGGGA
ATGGAGGGCGAGGTGTTCAGCGTGGTGGGCAAGCTGTCGGGCAACAAACT
GGTGCCGTACATAACCTCCCGTGGCGTTCCAGTGCTGCTCGTCTATCCGG
GTGGGCTCAGTGTCCAGGAAGTGTTCCGGTTGGAGGCTCGTGCCCAGGTC
TTGCACACCTGGTGGTGGCGCTTCGTCGGCTGGCTGCTGATCTTCTTCGG
CGTCACCTGCAACACCAAAATCCTTCGTCTGCTGTTTGTACGGGTGCCGC
TATTGGTGGCCTTGGCACCCGATCCTCAGTTCCCGGTTACGGGCAACCTA
CTCATCGCATTTTCGCTAGCTCTGACCATTGCGGCAGTCGCCTGGATCCT
GCATCGTCCTGTGATCGGCGCCTGCCTCTTACTGGCTGGCGCATCGCCTT
ACGTCTGGTTCACCCGCAATCTGGTCGACTACCATCGCCTGGACGCAAGC
TTTCTAGACCAT

BO19973.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG8111-RA 1131 CG8111-PA 1..1128 17..1144 5640 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG8111-RA 1340 CG8111-RA 88..1215 17..1144 5640 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7914059..7914651 935..343 2965 100 Minus
3L 28110227 3L 7914708..7915033 342..17 1630 100 Minus
3L 28110227 3L 7913789..7913997 1144..936 1045 100 Minus
Blast to na_te.dros performed 2014-11-26 14:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1a 5108 Rt1a DME278684 5108bp Derived from AJ278684 (AJ278684.1) (Rel. 64, Last updated, Version 1). 3069..3098 88..59 114 86.7 Minus

BO19973.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-13 10:09:10 Download gff for BO19973.complete
Subject Subject Range Query Range Percent Splice Strand
CG8111-RA 84..1211 17..1146 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:27:56 Download gff for BO19973.complete
Subject Subject Range Query Range Percent Splice Strand
CG8111-RA 88..1215 17..1146 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:04:03 Download gff for BO19973.complete
Subject Subject Range Query Range Percent Splice Strand
CG8111-RA 88..1215 17..1146 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:04:03 Download gff for BO19973.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7914708..7915033 17..342 100   Minus
3L 7914059..7914651 343..935 100 <- Minus
3L 7913787..7913997 936..1146 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:27:56 Download gff for BO19973.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7907808..7908133 17..342 100   Minus
arm_3L 7907159..7907751 343..935 100 <- Minus
arm_3L 7906887..7907097 936..1146 99 <- Minus

BO19973.pep Sequence

Translation from 16 to 1162

> BO19973.pep
MASLSETLRSHWPIALFGVILFVAGGTELYWNEGRAVHNMMALDEAHADI
YSVRFTEEEQEVGLEGRIVHLSGPILVGEPLTEPDYNIQLLAVKLRRRVQ
MYQWVEEAVEHNYGDSVGTTHSDSRTYYYTREWRDKIVDSRNFYNRHGHT
NPSHFPIESHVQVADAVFIGRYELGAEVKEKFNNYQELTSDIRPEDSGVK
LHLGIYYHTNDVFNPEVGDLRLLFSFAGMEGEVFSVVGKLSGNKLVPYIT
SRGVPVLLVYPGGLSVQEVFRLEARAQVLHTWWWRFVGWLLIFFGVTCNT
KILRLLFVRVPLLVALAPDPQFPVTGNLLIAFSLALTIAAVAWILHRPVI
GACLLLAGASPYVWFTRNLVDYHRLDASFLDH

BO19973.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:08:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG8111-PA 376 CG8111-PA 1..376 1..376 1990 100 Plus