Clone BO19985 Report

Search the DGRC for BO19985

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:199
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptCyp6a23-RA
Protein status:BO19985.pep: Imported from assembly
Sequenced Size:1540

Clone Sequence Records

BO19985.complete Sequence

1540 bp assembled on 2010-10-20

GenBank Submission: KX799386

> BO19985.complete
GAAGTTATCAGTCGACATGTCGCTGTTACTAACGTTGATCGCACTTCTAG
TGTCACTGCTTTTGTTCATGGCCCGCCGACGTCATGGATACTGGCAGAGG
CGGGGTATTCCGCACGATGTGCCCCATCCAATATACGGAAACATGAAGGA
CTGGCCCAAGAAGCGACACATTGCGATGATCTTCCGGGACTACTATACAA
AGTACAAACGTTCCGTTTATCCGTTTGCCGGGTTCTACTTCTTTTTCACC
CGGTCTGCTGTCATCACCGACTTGGAATTGGTCAAGAGGGTGCTGATCAA
GGACTTCAATCACTTTGAGAATCGAGGAATTTTCTACAATGAGATCGATG
ATCCGCTGTCGGCCACCTTGTTCAGCATCGAGGGTCAGAAGTGGCGTCAT
CTGAGGCACAAACTGACACCCACTTTTACGTCCGGCAAAATGAAGAACAT
GTTTCCGATTATTGTGAAGGTTGGGGAGGAAATGGAGAAGATTTTCAGTG
CTAAAACCACCACAGGTGAAGGTCAAGTTCTGGAAATTGTGGATCTGGTG
GCTCGATATACGGCTGACGTAATCGGTAATTGCGCCTTCGGTTTAAATTG
CAATAGTTTGCAAAACCCGAATGCAGAGTTTGTGACAATCGGAAAAAGGG
CGATCATAGAACGTCGTTATGGAGGACTATTGGATTTCCTGATATTCGGA
TTTCCCAAACTTTCCCGCCGCCTGCGGCTTAAACTAAACGTGCAGGATGT
TGAGGACTTTTACACTAGCATTGTTAGGAATACTATCGACTACCGATTGA
GGACCAACGAGAAGCGTCACGACTTCATGGACAGTTTAATCGAAATGTAC
GAGAAGGAGCAGGCCGGAAACACTGAGGATGGCCTGTCCTTCAACGAGAT
CTTGGCACAGGCCTTTATTTTCTTTGTGGCTGGCTTCGAGACCAGCTCGA
CGACCATGGGATTTGCCCTGTACGAGCTCGCCCTCGATCAGGATATTCAG
GATCAACTTAGGGCGGAGATCAACAATGTTCTGAGCAAACACAACAACGA
GTTTACCTACGAGGGAATCAAAGAGATGAAGTATCTGGAGCAGGTCGTCA
TGGAAACCCTTCGCAAGTATCCAGTTCTGGCGCATCTAACGCGAATGACC
CAGACAGATTTTTCGCCTGAAGATCCTAAATACTTTATTGCCAAGGGAAC
CACTGTTGTGATCCCAGCTCTTGGTATTCACTATGATCCGGAAATCTATC
CCGAACCGGAGAAGTTCAAGCCGGAGCGATTTACGGATGAGGCGATCGCC
GCGAGACCCTCGTGCACCTGGCTGCCGTTTGGAGAAGGTCCCCGGAACTG
CATCGGTCTTCGGTTTGGACTGATGCAGGCCTGCGTGGGATTGGCCTATC
TAATCCGAGGCTATAAGTTCAGTGTGTCCACAGAAACACAAATTCCCATG
AAGTTTGTCGTGAAAAGCATTCTTCTGTCTGCTGAGAATGGCATTCACCT
TAAAGTTGAGAAGCTTTCCAAAGCAAGCTTTCTAGACCAT

BO19985.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp6a23-RA 1509 CG10242-PA 1..1506 17..1522 7530 100 Plus
Cyp6a17-RB 1506 CG10241-PB 34..1503 53..1522 3075 80.6 Plus
Cyp6a17-RA 1506 CG10241-PA 34..1503 53..1522 3075 80.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp6a23-RA 1761 CG10242-RA 33..1538 17..1522 7530 100 Plus
Cyp6a17-RB 1727 CG10241-RB 61..1530 53..1522 3075 80.6 Plus
Cyp6a17-RA 1546 CG10241-RA 61..1530 53..1522 3075 80.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14875861..14876947 17..1103 5435 100 Plus
2R 25286936 2R 14877012..14877431 1103..1522 2100 100 Plus
2R 25286936 2R 14874013..14875063 53..1103 2015 79.4 Plus
2R 25286936 2R 14875123..14875542 1103..1522 1065 83.6 Plus
2R 25286936 2R 14882993..14883125 879..1011 260 79.7 Plus
Blast to na_te.dros performed on 2014-11-26 15:20:34 has no hits.

BO19985.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:27 Download gff for BO19985.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a23-RA 29..1534 17..1524 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:30:56 Download gff for BO19985.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a23-RA 33..1538 17..1524 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:11:21 Download gff for BO19985.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a23-RA 33..1538 17..1524 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:11:21 Download gff for BO19985.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14877013..14877431 1104..1524 99   Plus
2R 14875861..14876947 17..1103 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:30:56 Download gff for BO19985.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10764518..10764936 1104..1524 99   Plus
arm_2R 10763366..10764452 17..1103 100 -> Plus

BO19985.pep Sequence

Translation from 16 to 1540

> BO19985.pep
MSLLLTLIALLVSLLLFMARRRHGYWQRRGIPHDVPHPIYGNMKDWPKKR
HIAMIFRDYYTKYKRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHF
ENRGIFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIV
KVGEEMEKIFSAKTTTGEGQVLEIVDLVARYTADVIGNCAFGLNCNSLQN
PNAEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRLRLKLNVQDVEDFYT
SIVRNTIDYRLRTNEKRHDFMDSLIEMYEKEQAGNTEDGLSFNEILAQAF
IFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEG
IKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIP
ALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRF
GLMQACVGLAYLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVEKL
SKASFLDH

BO19985.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp6a23-PA 502 CG10242-PA 1..502 1..502 2622 100 Plus
Cyp6a17-PB 501 CG10241-PB 2..501 3..502 2283 84.4 Plus
Cyp6a17-PA 501 CG10241-PA 2..501 3..502 2283 84.4 Plus
Cyp6a20-PB 501 CG10245-PB 1..501 4..500 1460 54.8 Plus
Cyp6a19-PA 503 CG10243-PA 1..500 1..500 1369 50.1 Plus