Clone BO20287 Report

Search the DGRC for BO20287

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:202
Well:87
Vector:pDNR-Dual
Associated Gene/Transcriptdream-RA
Protein status:BO20287.pep: Imported from assembly
Sequenced Size:1615

Clone Sequence Records

BO20287.complete Sequence

1615 bp assembled on 2010-10-20

GenBank Submission: KX799019

> BO20287.complete
GAAGTTATCAGTCGACATGGGTTGGTGGAGCAAGAAAAGCGAGACGGATC
GCAGTCAGCCCAGCCAGGAACTGGTGGCGCAGGACCCGCGCACACGAGTC
CAGACTACGAGTGCAGCCACGGAGACGACCAACACAGCCGTGCAAAACTC
GACCATAACGGACAACAACAAGCAGACGGTTACCTTTCTCACCACCCGCC
AGACGGTGACGCACACGCAGCGGGCGCTGATCACGGAGACGACAACGCGA
CGCACGCCTAGTCAGGCGGAGTTAGAGGCTCTCTTCGCAAAGATAAAGAT
GGGCGGTGAGGGACCCATTGGCTCCACCACCACCACTACGACGACCACCT
CCTCGCGCTCCCGACCGCCCAGTTTGAACGGCGTCTCCTTTCGCTCCACA
CAACCCTTCAAAGCCACGGCAAGCAATGCTGGCAAACGGTCAAGCACCTT
AGTCAAGACCGAGCAGACGACAGTGACCCAAAAGAATGGGCGCACGGTCA
CCCAGCACCTGGAGACTCATAGAGTGGACCTCAAGGGAAGTCGACCTAAG
GCGACCTGGGCGTCATTTGCGTCCACTGCAAACAGCTCAACATCCAGCTA
CGTCTCACCTTATCGTCAGAAGCCAAGCATGGCCATAACTTGCACATCTC
CCAACATCAAGACACCAAAAACCACTAGCTCCACGTCCAGTTCCAGTGCC
AGCTCCATTACGAGTCCGCCCAAACCATCATCATCTGTATCCTCCATTTC
AAGCATTTTCAAGTCCGCTCCCAAGCAAGTTGACAAGCCGCTCAGTTCTA
CCGCAACTCCCAAGCCCTTCATTAGTCTGGGATCGTCAGGAGGCACCAAG
CCGAAGGTCACTGCCGTCGCGCAATCCCAAGATGCCCAGGGCACGATTTC
AACGAGCCTGGGTATCTCGAAATCAAGCCTGACCAAGAACAAACTCAAGC
CCGCCCGGGTGTATATCTTCAACCACGAGCGGTTCGATAACAAGAACGAA
TTCCGAAAGGGAAGTGCCCAGGATGTGAAGGTCTTGCGCGCCACCTTTGA
GCAGCTGAAGTGCAAAGTGGAAGTTATTACAGATGCAACCCTGGTCACCA
TTAAAAAAACAGTGCGAATGTTGCAAACCAAGGACTTTGAGGACAAAAGC
GCTCTGGTCCTCGTGATCCTCAGTCATGGAACGCGCCACGACCAGATCGC
AGCAAAGGATGACGACTACTCCCTGGACGACGACGTTGTTTTTCCCATTT
TGCGCAATAGGACGCTTAAGGACAAGCCCAAGCTGATTTTCGTTCAGGCC
TGCAAGGGCGACTGCCAACTAGGGGGCTTTATGACCGATGCCGCGCAGCC
CAATGGGTCTCCAAATGAAATCCTCAAGTGCTATAGCACGTACGAGGGAT
TTGTATCTTTTCGCACGGAGGACGGAACTCCTTTTATTCAGACACTGTGT
GAAGCTCTTAATCGATCGGGGAAGACTTCAGACATCGACACCATAATGAT
GAATGTGCGTCAAGTGGTTAAAATGCAATCCAAAGACCGCCAAATTCCAT
CTGTCACTAGCACTCTTACCTCTAAGTACGTTTTTGGAGATTATATTGCA
AGCTTTCTAGACCAT

BO20287.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:22:10
Subject Length Description Subject Range Query Range Score Percent Strand
Strica-RB 1584 CG7863-PB 1..1581 17..1597 7905 100 Plus
Strica-RA 1584 CG7863-PA 1..1581 17..1597 7905 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:22:11
Subject Length Description Subject Range Query Range Score Percent Strand
Strica-RB 2720 CG7863-RB 103..1683 17..1597 7905 100 Plus
Strica-RA 2163 CG7863-RA 103..1683 17..1597 7905 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6021938..6023042 1121..17 5525 100 Minus
2R 25286936 2R 6021471..6021882 1533..1122 2060 100 Minus
2R 25286936 2R 6021348..6021411 1597..1534 320 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:22:09 has no hits.

BO20287.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:38 Download gff for BO20287.complete
Subject Subject Range Query Range Percent Splice Strand
dream-RA 165..1745 17..1599 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:31:13 Download gff for BO20287.complete
Subject Subject Range Query Range Percent Splice Strand
dream-RA 103..1683 17..1599 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:11:48 Download gff for BO20287.complete
Subject Subject Range Query Range Percent Splice Strand
Strica-RA 103..1683 17..1599 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:11:48 Download gff for BO20287.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6021938..6023042 17..1121 100   Minus
2R 6021471..6021882 1122..1533 100 <- Minus
2R 6021344..6021411 1534..1599 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:31:13 Download gff for BO20287.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1909443..1910547 17..1121 100   Minus
arm_2R 1908976..1909387 1122..1533 100 <- Minus
arm_2R 1908849..1908916 1534..1599 97 <- Minus

BO20287.pep Sequence

Translation from 16 to 1615

> BO20287.pep
MGWWSKKSETDRSQPSQELVAQDPRTRVQTTSAATETTNTAVQNSTITDN
NKQTVTFLTTRQTVTHTQRALITETTTRRTPSQAELEALFAKIKMGGEGP
IGSTTTTTTTTSSRSRPPSLNGVSFRSTQPFKATASNAGKRSSTLVKTEQ
TTVTQKNGRTVTQHLETHRVDLKGSRPKATWASFASTANSSTSSYVSPYR
QKPSMAITCTSPNIKTPKTTSSTSSSSASSITSPPKPSSSVSSISSIFKS
APKQVDKPLSSTATPKPFISLGSSGGTKPKVTAVAQSQDAQGTISTSLGI
SKSSLTKNKLKPARVYIFNHERFDNKNEFRKGSAQDVKVLRATFEQLKCK
VEVITDATLVTIKKTVRMLQTKDFEDKSALVLVILSHGTRHDQIAAKDDD
YSLDDDVVFPILRNRTLKDKPKLIFVQACKGDCQLGGFMTDAAQPNGSPN
EILKCYSTYEGFVSFRTEDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQV
VKMQSKDRQIPSVTSTLTSKYVFGDYIASFLDH

BO20287.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
Strica-PB 527 CG7863-PB 1..527 1..527 2663 100 Plus
Strica-PA 527 CG7863-PA 1..527 1..527 2663 100 Plus
Damm-PB 255 CG18188-PB 34..251 309..526 447 45.3 Plus
Damm-PA 255 CG18188-PA 34..251 309..526 447 45.3 Plus
Dcp-1-PA 323 CG5370-PA 83..315 317..525 248 34.6 Plus