Clone BO20375 Report

Search the DGRC for BO20375

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:203
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptCG12424-RA
Protein status:BO20375.pep: Imported from assembly
Sequenced Size:2806

Clone Sequence Records

BO20375.complete Sequence

2806 bp assembled on 2010-10-20

GenBank Submission: KX797960

> BO20375.complete
GAAGTTATCAGTCGACATGCATCGTTCGCTGAAGCCGCATGCATCCACCG
CACAGGCTAAGAAGGTGCAACCGCCAACGATACCAGGCGACTCGCCGCAG
GATTTGCATCTCTATCAGCAGCCGCAGCAGCTTCACCACCACCACCATCA
ACACCCAAACCATCATCATCCGCACCACCAGCCATCGATACCGCTCTATC
GGCTAAGCGGACCACTGCGCCATCATCAAAACCACCAGGCGGACGATGGG
ATCAGCATGAGCGGCAGCAGCATCGTTTCGTCGCCCTCGCTGGAGGAGGG
TGGCTTCAATTTGCCGCGGGAGACGAGTGTGGCCCTGCGTCTTAAGGATG
AAGTGGGTGGCACTTCAACGGCAGCCCCAACCACTGGCGGCCCAGGAGGA
GGTGGAGCGACGGTGGTGGGAGCACCACCACCCGGTGCCGGAAAGCCCGG
CGTAGCCATGGTTCCACCGCCACCCGTTTTCTGTGCCACTTTGCGCGAAC
CGCTGACCCACAAAGCGGCCGTCTACTACCACCAACAGCTGGCCCTGCAG
GAGGATCAGGGCATCGATCTAACCCAATCGCCTGGCCGAGACTCGCCGGG
CTCGTCGTCGGGCTCGGCGGGCTCTGGATCTCGTCACAGCACCGCCAGCT
TGGACTCGGGTCGGGCCTCCTCCTACCTGACGGGCGTGTCCTCGTCGGGC
GCCTCGATTCGTGCTCCGCTCTCCTCGCCGCGCTGCAGTTCCGTCAGCTC
GTGCTCCATTGGCAGTGTGGATCGGCAGCGCAACGATGAGCTCATCATCG
ACTGGCTGCTCGAGATGAAGCACGAGGAGTACGCGCAGCTGTTCATCGCC
GCGGGCTATGATCTGCCCACCATTGCGCGCATGACGCCGGAGGATCTCAC
CGCCATTGGCATTAAGAATCCGCATCATCGGGAGCGGATCAAGCAGCGGA
TCGACAAGCTGCAGGTGCTCGACAATTTGCCGCATTTCGTGCCGGGATCC
ATAGAGGAATGGCTGCAGCTGCTGCGTCTGGAGGAGTATATACAGCCCCT
GCTGGAGCAGAACTATAAGACGGTGCGCGACGTAACCCAAGTGACTTGGG
AGGATCTCGAGGACATTGGCATTGTCAAGCTGGGCCACCAAAAGAAAATT
CTGCTGGCCATCAAGCGTGTGAAGGACATAATTAGCGGAAAGTGGAACCC
AGGCGGCGCCAATGCCTACCAACAGCAGGAGTACCAGCGGAAGCCCTGGC
AATTCAATGTGCCCATACCCAGTACGCCATCCTATGTGCCAACCACCCGC
GTCTCGTGGGACGACACGAAAATCTACGCGACCAGCAGTGTCTTGAATTC
CACTGCCCCATCCGGGAGCAGCTGCCTCAATAGCAGCCTTGCCAACGGAG
ATGCCTACTACTGCACGGGCAGTAACCATGAGTGCTGCTCGGGCAACGAT
GTGGTGCTCATTAAGGTTCGCCAGCCGCGCGGCAAGAGCCTGGAATCTTT
GGAGGACATCCACGACAACAGCACGCGCAGCCATCTGACCTTCAGCCATT
ACACAACCACGGACTACGGCCACTTTGGGCCGCCGACAACAGCGGCGGCT
GCAGCGGCAATGGCCGCAGCGGCCACACTGCAGCAGCAGCATCATCACCA
GCAGCTGCTCCACCAGCAACAGCAGCAGGCAGCTGCCGCCCGTCTCCTGG
GCAACAATGCGCCTGGCATTGGATGGCGGCGATCCTACGACGACGGCGAC
ATCACACCCACCAACGATGCCACGAGGGAGCTGCTCTACGAGCAGGAGGG
CGGCGGAACTCTGCCACGCCAGCAGCGTGGCATCCTGCAGCGGGCGGTGT
TGAACACCATGCCGCCACTGGAGCACCATCACTACATGAATGCAGCGGCT
GCGGCGGAGTACGGTGCGGCCAGCGGTGTGGAGGGTGGAGCGAATTACAT
GGGCGGCAGTCCTTTGACGGGCAAGAAAATAGCTCCTGAGCCACCTAGAC
GCCACTGCAGCATACGCAACTCCCGCACGCTGAGCGGAGAGGGAGTGCCG
TCGGGAGCGGCTGCGCAGGCGCATCAGCAGGCAGCCCAACAGCAGCAGGG
CCAGCACATGTTCTACGGCCACACGGCGCAGCACTGGCAGCAGCAGCAGC
AGCAGGCGGGTGCAGGTACTGGTCAGCAGCCGATCTACGCCAACTATGCC
ACCATACAACAGACAACGGCGGAGATACACTGTGAGAAGTATCACGACAG
TAAGTCGACTTCCAGCATCGATTCGATTGACACGATACCATTTGCCAACG
AGAACACTGGGACGATAAAACAGCGGCTGCTCAACCGCCAGGAGCTGCAG
GGCGGCGGAGCGGGCAACAACAATGTACCCGGCGGCGGCCATCCCGCACA
CCTGCACTCCTCCAGCTCGAGCTCCAGCTCCTCCTCCACGAACACCATCG
CGAATATAGCGCACTCGTTCCATTCGTTGAAATCTTCCAGTTCGCTGCAC
GATGCCACATTGGCGCGGAGTGAAAGCATGGGCAGCACAGCCAGCGGTGG
AAGTGCCTTGCACCTGCGTTCACCCACATTGGATATGTCAAATGCCGGTG
GATCAACGGCGGAGCCTGCAAGTTCGCCAGAAGCAGCCGTACCAACTGTG
GCCATAAACAACGGCGTTCCGCCCAAAGTTTCGGTGAACGTTCTGAACGA
CATTGGCAATATGCTGGCCAATCTCACGGACGAGCTGGACGCCATGCTGG
AGGAGGAGAAGCGAGTGGGCCTAAACATAGACAGTGAAGCAAGCTTTCTA
GACCAT

BO20375.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
ckn-RE 2775 CG12424-PE 1..2772 17..2788 13860 100 Plus
ckn-RB 2775 CG12424-PB 1..2772 17..2788 13860 100 Plus
ckn-RC 2775 CG12424-PC 1..2772 17..2788 13860 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:22:00
Subject Length Description Subject Range Query Range Score Percent Strand
ckn-RE 4568 CG12424-RE 683..3455 16..2788 13865 100 Plus
ckn-RB 4039 CG12424-RB 365..3137 16..2788 13865 100 Plus
ckn-RC 4357 CG12424-RC 683..3455 16..2788 13865 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:21:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14971778..14972757 16..995 4900 100 Plus
2R 25286936 2R 14978836..14979682 1942..2788 4235 100 Plus
2R 25286936 2R 14978228..14978706 1464..1942 2395 100 Plus
2R 25286936 2R 14977684..14977925 1226..1467 1210 100 Plus
2R 25286936 2R 14977239..14977474 994..1229 1180 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:21:58 has no hits.

BO20375.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:33 Download gff for BO20375.complete
Subject Subject Range Query Range Percent Splice Strand
CG12424-RB 370..3141 17..2790 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:31:08 Download gff for BO20375.complete
Subject Subject Range Query Range Percent Splice Strand
ckn-RC 684..3455 17..2790 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:11:46 Download gff for BO20375.complete
Subject Subject Range Query Range Percent Splice Strand
ckn-RC 684..3455 17..2790 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:11:46 Download gff for BO20375.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14978837..14979682 1943..2790 99   Plus
2R 14978230..14978706 1466..1942 100 -> Plus
2R 14977687..14977923 1229..1465 100 -> Plus
2R 14977240..14977473 995..1228 100 -> Plus
2R 14971779..14972756 17..994 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:31:08 Download gff for BO20375.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10866342..10867187 1943..2790 99   Plus
arm_2R 10865735..10866211 1466..1942 100 -> Plus
arm_2R 10865192..10865428 1229..1465 100 -> Plus
arm_2R 10864745..10864978 995..1228 100 -> Plus
arm_2R 10859284..10860261 17..994 100 -> Plus

BO20375.pep Sequence

Translation from 16 to 2806

> BO20375.pep
MHRSLKPHASTAQAKKVQPPTIPGDSPQDLHLYQQPQQLHHHHHQHPNHH
HPHHQPSIPLYRLSGPLRHHQNHQADDGISMSGSSIVSSPSLEEGGFNLP
RETSVALRLKDEVGGTSTAAPTTGGPGGGGATVVGAPPPGAGKPGVAMVP
PPPVFCATLREPLTHKAAVYYHQQLALQEDQGIDLTQSPGRDSPGSSSGS
AGSGSRHSTASLDSGRASSYLTGVSSSGASIRAPLSSPRCSSVSSCSIGS
VDRQRNDELIIDWLLEMKHEEYAQLFIAAGYDLPTIARMTPEDLTAIGIK
NPHHRERIKQRIDKLQVLDNLPHFVPGSIEEWLQLLRLEEYIQPLLEQNY
KTVRDVTQVTWEDLEDIGIVKLGHQKKILLAIKRVKDIISGKWNPGGANA
YQQQEYQRKPWQFNVPIPSTPSYVPTTRVSWDDTKIYATSSVLNSTAPSG
SSCLNSSLANGDAYYCTGSNHECCSGNDVVLIKVRQPRGKSLESLEDIHD
NSTRSHLTFSHYTTTDYGHFGPPTTAAAAAAMAAAATLQQQHHHQQLLHQ
QQQQAAAARLLGNNAPGIGWRRSYDDGDITPTNDATRELLYEQEGGGTLP
RQQRGILQRAVLNTMPPLEHHHYMNAAAAAEYGAASGVEGGANYMGGSPL
TGKKIAPEPPRRHCSIRNSRTLSGEGVPSGAAAQAHQQAAQQQQGQHMFY
GHTAQHWQQQQQQAGAGTGQQPIYANYATIQQTTAEIHCEKYHDSKSTSS
IDSIDTIPFANENTGTIKQRLLNRQELQGGGAGNNNVPGGGHPAHLHSSS
SSSSSSSTNTIANIAHSFHSLKSSSSLHDATLARSESMGSTASGGSALHL
RSPTLDMSNAGGSTAEPASSPEAAVPTVAINNGVPPKVSVNVLNDIGNML
ANLTDELDAMLEEEKRVGLNIDSEASFLDH

BO20375.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:41:34
Subject Length Description Subject Range Query Range Score Percent Strand
ckn-PE 924 CG12424-PE 1..924 1..924 4867 100 Plus
ckn-PB 924 CG12424-PB 1..924 1..924 4867 100 Plus
ckn-PC 924 CG12424-PC 1..924 1..924 4867 100 Plus
ckn-PD 845 CG12424-PD 1..845 1..924 3348 74.2 Plus
ckn-PF 642 CG12424-PF 45..642 327..924 3133 100 Plus