Clone BO20458 Report

Search the DGRC for BO20458

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:204
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptUpf2-RA
Protein status:BO20458.pep: Imported from assembly
Sequenced Size:3757

Clone Sequence Records

BO20458.complete Sequence

3757 bp assembled on 2010-10-20

GenBank Submission: KX798213

> BO20458.complete
GAAGTTATCAGTCGACATGCTAGCCAACGATTCTGCAACGACTGACAGCG
AGGTGTCCACACCGCCGTCGTCGAGGAAAGATTTGGCAGATGGTGTTGCC
GAGGGTGACAACGACAACGACATCGATACCGGCGACACGGACGCAAATGC
GGATGAAGATGTGGATGCGGCTGCTGCCATTGCCCTGGAGGCCGAAGAGC
GCGAGGAGCTGCAACAGTTCATAAGCGAGCTGCGCGAGAAGATCGAGAGC
AAGCGACAGCTGCGCCTCCAAAACTCCACAATCGAGCTGCCCGGTGAGGA
GTACTTCGCCAAACTGGACTCCAATCTCAAAAAGAACACGGCATTCGTCA
AGAAACTGAAACTATTCACGGCCACACAGCTGGACGGACTATTGCGTGAG
ATATCTGCTCTAAACCTGAGCAAATACATCTCGGAAATATGCGCCGCGCT
GGTCGAGGCCAAACTGAAAATGACTGATGTGCCGGCGGTGGTGACGCTGG
CCTCTCGGCTGCACTGCACATATGCCGACTTCGATGTCCATTTTCTGGAG
GCCTGGCAAAAGGCACTGAACATCAAGGCCACCGAGAAGATTGGCAATCC
GAGCAAACTGCGCGTGGATCTTCGCCTGTTCGCCGAACTAGTCAGCTCTG
GTGTGATCCAAATGAAGCCCGGATTGGCCCAACTGGGTGTTGTTCTGGTG
CATTTGATTGCCCTGGACAAGGATGACCACAGCAACTTCTCGATCATCCT
CTCATTCTGCCGGCACTGCGGCGAGGAGTACGCCGGCCTAGTGCCGCAAA
AGATGCAACAGTTGGCCACCAAATACGGGGTGGAGGTGCCGAAATCCGAC
TTCCTGACTGCCGACAAGCAGCTCAATCTGCGCACCATGCTTAAGGGTTA
CTTCAAGGCCCTGTGCAAGCATGTCCTGGCCGAGCAGGCCGAACTGATGA
ACATGACCAAGAACATTCGGCGCACCATGGAGTGCAAGGGTGAGATATCC
ACGGAGAAGCGCGAGAAGTGTGAACTGATGCAGGCCGGATTCGATAAGCT
GCTGGCCTCCGCTCAATCGCTGTCGGAACTGCTGGGTGAACCACTGCCCG
AGCTGGCCAAGGAGTCTGAGGGCTGTAATCCGGGCACAGTCATCGACAAC
ATGCTGGACAGTGCCTCCTTTGGTGTGCTGGATCCGTGGGGCGACGAGGA
GACCCGAGCCTTCTACACGGATTTGCCCGATTTGAGACAGTTTCTGCCAA
ACTTTTCGGCACCCAAAGTCGATTTGGAAACGTTAGAGGAGCCCAGTGAA
CTAACCGAAGAAGCGATCGATGCCAATCTAGATGCCGAAATGGATCTAGA
TGATCCACCGTCCACCACTTCGGATACGACTCCGGAGAATCCAATCGAAG
AGCAGCCAACGACGCCAGTTGCCGCTGCGGAGGATCTCAAGCCGCAGAAG
ATGGGTAACGCTCTAATGGAACTGGGTCGCCAGCAGCAGCAGCAAAGTCA
GCTCAACCAGAATCCGATCCAGATCCAAAACCAGATGCGTCAGCAGTTCG
ATGGCTTCCTGGTCAACCTATTCAACTGTGTGAACAAGGAGCTGATCGAT
TCGGCGGCCATCGAGTTCCTGCTTAACTTCAATACCAAGCATCAACGCAA
GAAGCTGACGCGTACGATATTCTCGGTGCAGCGTACGCGTCTGGATATCC
TGCCCTATCTCTCCCGCTTCGTGGCCATTGTGCATATGTGCAATACCGAT
GTGGCCACCGATTTGGCCGAACTGCTGCGCAAGGAGTTCAAGTGGCACAT
TCACAAGAAGAACCAGCTGAATATCGAGACGAAGCTTAAGATTGTGCGAT
TCATTGGTGAACTGGTTAAGTTTGGTTTGTTTAAAAAGTTCGATGCCTTA
GGATGTCTGAAGATGCTGCTAAGGGACTTTCAGCATCATCAAATCGAGAT
GGCCTGTGCCTTTGTGGAAGTCACCGGCGTCTATCTGTACAATTGCCGGG
ATGCCCGTCTGCTGATGAATGTGTTCCTGGACCAGATGCTGCGCTTGAAA
ACAGCCACGGCAATGGACTCGCGACATGCGGCGCAGATTGAGAGCGTGTA
CTATTTGGTAAAGCCGCCGGAATCGTCCAAGCGAGAGCCCATGGTTCGGC
CGGCAATGCATGAGTACATCCGTTACTTGATCTTCGAGGAGCTTTGCAAA
CAGAACGTTGATCGTTGTATCAAAATGCTGCGCCGCATCGATTGGCAGGA
TCCGGAGACAAATTGTTATGCCATTAAGTGCCTCAGCAAGGCGTATCTGC
TGCGCTTCCAGCTCATCCGCTGTCTGGCCGATCTCGTATCCGGACTGAGC
TCCTATCAGCCACGAGCGGTTACCATCGTGATCGATAATGTGTTTGAGGA
TATACGCGCTGGCCTCGAGATTCATTCGCCACGCATGGCACAGCGGCGCA
TCGCGATGGCCAAGTATCTGGGCGAGATGTACAACTACAAGCTGGTGGAG
TCCACGAACATTCTTAATACGCTGTACTCCATCATCTCGCTGGGCGTATC
GAATGACCAAAATGTCGTCTCGCCACTGGATCCGCCCGATAGCCTGTTCC
GACTGAAGCTTGCCTGTATGCTACTGGACACGTGTGCACCCTACTTCACC
AGCCAGGCCACGCGAAAAAAACTGGACTACTTTCTGGTCTTCTTCCAACA
CTACTATTGGTTCAAGAAATCCCATCCCGTGTTCAGCAAAACGGAGAACA
CCTCCGATTTGTTCCCCATCCTAATGGATCACACCTATCGCGACTGTCTA
CTCAATGTGCGGCCCAAGCTGAAGATTTACAAGAGTCTAGAGCAGGCCAA
GGCGGCGATTGATCATCTGCAGGAGAAGCTCTATCCGCAGCTAAAGACTA
CCAATAATGCTCAGGATCCGTCGCTGGGCACAATCAGTGAAATAAGCGAG
ATAGACGAGGGCGGCACTGATGAGGATTCTGGGTCATCGAATGATCAGCG
AGAGCGCCAAGTGTCGGGCCAAGAGCAGGACCAGAGCAACGACTGGACAG
AGAACGAGGCGGAGCCACCGCTGCCGCCGCTCCCGCCGCCAGAAAAGTCC
AAGGAGGACCTGGAGTTCGAGCAATTGTACGAAAAAATGACCACAGACTC
GTACCAAGAACGGCTTAAGGAGCCGATAAAGGCTACGGCCAAGGATATAC
CTGTGCCGATGATGGCGCGCCTGCAAAAAAAATCGTACGATCAGATAACA
GGTGCTCAGACCATCGGCCCTGGGATCAACAATATGTCACAGATCTCAAA
GTCGGTCCCCAATCAGGACGGAACGCCTGGCTCTCCAGGTGCAGATTCAC
CAGATGGCAACGGCAAATCCGGCGGCGGTGTAGGTGGTAGCGATGTTGGT
GCTGCTGGTGCTGCTGGTGCTTCTGGTGCTACATCTGTACCCTTTGTGCT
AATGGTGCGCGGCCACAAGGGCGGAAAGCAGCAATTTAAGTCATTTGTGG
CACCATCCGACTCGCACTTGGCCACCAACCTAAAGCGGCAGGAGCAGATG
ATACGCGAGGAGAAGGAGAAGGTCAAGCGCCTTACGCTTAACATAACTGA
GCGCATTGAGGAGGAGGACTACCAGGAGTCGTTGATGCCGCCGCAGCATC
GAAACTTCACCCAGAGCTACTACCAGAAGCCCAATAAGCACAAGTTCAAG
CACCAAAAGGGTGCGCCCGATGCGGACCTCATATTTCACGCAAGCTTTCT
AGACCAT

BO20458.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:07:21
Subject Length Description Subject Range Query Range Score Percent Strand
Upf2-RA 3726 CG2253-PA 1..3723 17..3739 18615 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
Upf2-RA 5078 CG2253-RA 311..4034 16..3739 18620 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:07:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8072502..8075156 2670..16 13275 100 Minus
X 23542271 X 8071288..8072064 3739..2963 3885 100 Minus
X 23542271 X 8072128..8072420 2963..2671 1465 100 Minus
Blast to na_te.dros performed 2014-11-26 15:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1526..1587 3438..3377 121 66.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6845..6913 1481..1546 121 68.1 Plus

BO20458.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:47:33 Download gff for BO20458.complete
Subject Subject Range Query Range Percent Splice Strand
Upf2-RA 321..4043 17..3741 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:29:12 Download gff for BO20458.complete
Subject Subject Range Query Range Percent Splice Strand
Upf2-RA 312..4034 17..3741 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:06:54 Download gff for BO20458.complete
Subject Subject Range Query Range Percent Splice Strand
Upf2-RA 312..4034 17..3741 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:06:54 Download gff for BO20458.complete
Subject Subject Range Query Range Percent Splice Strand
X 8072502..8075155 17..2670 100   Minus
X 8072129..8072420 2671..2962 100 <- Minus
X 8071285..8072064 2963..3741 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:29:12 Download gff for BO20458.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7966535..7969188 17..2670 100   Minus
arm_X 7966162..7966453 2671..2962 100 <- Minus
arm_X 7965318..7966097 2963..3741 99 <- Minus

BO20458.pep Sequence

Translation from 16 to 3757

> BO20458.pep
MLANDSATTDSEVSTPPSSRKDLADGVAEGDNDNDIDTGDTDANADEDVD
AAAAIALEAEEREELQQFISELREKIESKRQLRLQNSTIELPGEEYFAKL
DSNLKKNTAFVKKLKLFTATQLDGLLREISALNLSKYISEICAALVEAKL
KMTDVPAVVTLASRLHCTYADFDVHFLEAWQKALNIKATEKIGNPSKLRV
DLRLFAELVSSGVIQMKPGLAQLGVVLVHLIALDKDDHSNFSIILSFCRH
CGEEYAGLVPQKMQQLATKYGVEVPKSDFLTADKQLNLRTMLKGYFKALC
KHVLAEQAELMNMTKNIRRTMECKGEISTEKREKCELMQAGFDKLLASAQ
SLSELLGEPLPELAKESEGCNPGTVIDNMLDSASFGVLDPWGDEETRAFY
TDLPDLRQFLPNFSAPKVDLETLEEPSELTEEAIDANLDAEMDLDDPPST
TSDTTPENPIEEQPTTPVAAAEDLKPQKMGNALMELGRQQQQQSQLNQNP
IQIQNQMRQQFDGFLVNLFNCVNKELIDSAAIEFLLNFNTKHQRKKLTRT
IFSVQRTRLDILPYLSRFVAIVHMCNTDVATDLAELLRKEFKWHIHKKNQ
LNIETKLKIVRFIGELVKFGLFKKFDALGCLKMLLRDFQHHQIEMACAFV
EVTGVYLYNCRDARLLMNVFLDQMLRLKTATAMDSRHAAQIESVYYLVKP
PESSKREPMVRPAMHEYIRYLIFEELCKQNVDRCIKMLRRIDWQDPETNC
YAIKCLSKAYLLRFQLIRCLADLVSGLSSYQPRAVTIVIDNVFEDIRAGL
EIHSPRMAQRRIAMAKYLGEMYNYKLVESTNILNTLYSIISLGVSNDQNV
VSPLDPPDSLFRLKLACMLLDTCAPYFTSQATRKKLDYFLVFFQHYYWFK
KSHPVFSKTENTSDLFPILMDHTYRDCLLNVRPKLKIYKSLEQAKAAIDH
LQEKLYPQLKTTNNAQDPSLGTISEISEIDEGGTDEDSGSSNDQRERQVS
GQEQDQSNDWTENEAEPPLPPLPPPEKSKEDLEFEQLYEKMTTDSYQERL
KEPIKATAKDIPVPMMARLQKKSYDQITGAQTIGPGINNMSQISKSVPNQ
DGTPGSPGADSPDGNGKSGGGVGGSDVGAAGAAGASGATSVPFVLMVRGH
KGGKQQFKSFVAPSDSHLATNLKRQEQMIREEKEKVKRLTLNITERIEEE
DYQESLMPPQHRNFTQSYYQKPNKHKFKHQKGAPDADLIFHASFLDH

BO20458.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
Upf2-PA 1241 CG2253-PA 1..1241 1..1241 6404 100 Plus