Clone BO20606 Report

Search the DGRC for BO20606

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:206
Well:6
Vector:pDNR-Dual
Associated Gene/Transcriptort-RA
Protein status:BO20606.pep: Imported from assembly
Sequenced Size:1489

Clone Sequence Records

BO20606.complete Sequence

1489 bp assembled on 2010-10-20

GenBank Submission: KX798715

> BO20606.complete
GAAGTTATCAGTCGACATGGTGTTCCAAATAATAATCCTGGTGATCTGCA
CCATCTGCATGAAGCACTACGCCAAAGGGGAGTTTCAACAAAGTCTGGCC
ATAACCGACATCCTGCCCGAGGACATCAAGCGTTACGACAAGATGAGACC
GCCGAAGAAAGAGGGTCAGCCGACGATAGTCTACTTCCATGTGACGGTGA
TGGGTCTGGACTCCATTGATGAGAACTCGATGACTTATGTGGCGGATGTG
TTCTTTGCACAGACGTGGAAGGATCATCGCCTGCGATTGCCGGAGAATAT
GACACAGGAATACCGCCTGCTCGAGGTGGACTGGCTAAAAAATATGTGGC
GGCCGGATTCGTTTTTCAAAAACGCCAAATCGGTGACCTTTCAGACCATG
ACAATACCCAATCACTATATGTGGCTGTACAAGGATAAGACCATTCTGTA
CATGGTCAAACTAACACTGAAGCTGTCCTGCATCATGAACTTCGCCATTT
ATCCTCATGATACACAGGAGTGCAAGCTGCAAATGGAAAGCCTGTCCCAC
ACCACGGATGACTTGATATTCCAGTGGGATCCAACAACGCCCCTTGTGGT
TGATGAAAACATCGAACTGCCGCAGGTGGCCCTCATCCGAAATGAAACGG
CGGACTGTACCCAAGTTTATTCCACTGGCAACTTCACATGCCTGGAGGTG
GTGTTCACCCTTAAGCGTCGTTTGGTTTACTACGTTTTCAACACCTACAT
TCCCACCTGCATGATAGTGATCATGTCATGGGTATCCTTCTGGATCAAAC
CGGAGGCGGCACCAGCCCGTGTGACTCTGGGTGTCACCTCCTTGCTAACG
CTTTCCACGCAACACGCCAAATCGCAGTCGTCTTTGCCACCTGTTTCCTA
TCTCAAGGCAGTGGACGCCTTTATGTCCGTTTGCACGGTGTTCGTGTTTA
TGGCCCTCATGGAGTATTGTCTAATAAACATCGTCCTGAGCGACACGCCC
ATTCCCAAGCCGATGGCCTATCCACCCAAACCTGTGGCGGGAGATGGGCC
CAAGAAAGAGGGCGAGGGTGCTCCTCCTGGGGGCAGCAACTCGACGGCCA
GCAAGCAACAAGCCACCATGTTGCCACTGGCCGATGAAAAGATCGAGAAA
ATTGAGAAGATCTTTGACGAGATGACCAAGAATAGAAGGATTGTAACCAC
CACACGCCGCGTGGTGCGTCCGCCATTGGACGCCGATGGTCCGTGGATTC
CGCGACAGGAGTCGCGGATAATACTGACCCCGACTATCGCTCCGCCGCCA
CCGCCCCCTCAGCCAGCGGCACCGGAACCGGAACTGCCCAAGCCGAAACT
CACACCCGCCCAGGAGCGGCTCAAGCGGGCTATATATATAGATCGGTCCT
CGCGCGTCCTTTTCCCCGCCCTCTTCGCCAGTCTGAATGGCATCTACTGG
TGTGTGTTCTACGAGTATCTAGCAAGCTTTCTAGACCAT

BO20606.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
ort-RA 1458 CG7411-PA 1..1455 17..1471 7275 100 Plus
HisCl1-RD 1251 CG14723-PD 232..495 167..430 285 73.9 Plus
HisCl1-RC 702 CG14723-PC 232..495 167..430 285 73.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
ort-RA 2158 CG7411-RA 349..1803 17..1471 7275 100 Plus
HisCl1-RD 1693 CG14723-RD 548..811 167..430 285 73.9 Plus
HisCl1-RC 1707 CG14723-RC 430..693 167..430 285 73.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19662286..19662932 543..1189 3235 100 Plus
3R 32079331 3R 19661721..19662175 88..542 2275 100 Plus
3R 32079331 3R 19663035..19663317 1189..1471 1415 100 Plus
3R 32079331 3R 19661592..19661662 17..87 355 100 Plus
3R 32079331 3R 11788021..11788219 232..430 185 72.9 Plus
Blast to na_te.dros performed on 2014-11-26 15:19:15 has no hits.

BO20606.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:23 Download gff for BO20606.complete
Subject Subject Range Query Range Percent Splice Strand
ort-RA 349..1803 17..1473 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:30:44 Download gff for BO20606.complete
Subject Subject Range Query Range Percent Splice Strand
ort-RA 349..1803 17..1473 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:10:55 Download gff for BO20606.complete
Subject Subject Range Query Range Percent Splice Strand
ort-RA 349..1803 17..1473 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:10:55 Download gff for BO20606.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19663036..19663317 1190..1473 99   Plus
3R 19662286..19662932 543..1189 100 -> Plus
3R 19661721..19662175 88..542 100 -> Plus
3R 19661592..19661662 17..87 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:30:44 Download gff for BO20606.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15488758..15489039 1190..1473 99   Plus
arm_3R 15488008..15488654 543..1189 100 -> Plus
arm_3R 15487443..15487897 88..542 100 -> Plus
arm_3R 15487314..15487384 17..87 100 -> Plus

BO20606.pep Sequence

Translation from 16 to 1489

> BO20606.pep
MVFQIIILVICTICMKHYAKGEFQQSLAITDILPEDIKRYDKMRPPKKEG
QPTIVYFHVTVMGLDSIDENSMTYVADVFFAQTWKDHRLRLPENMTQEYR
LLEVDWLKNMWRPDSFFKNAKSVTFQTMTIPNHYMWLYKDKTILYMVKLT
LKLSCIMNFAIYPHDTQECKLQMESLSHTTDDLIFQWDPTTPLVVDENIE
LPQVALIRNETADCTQVYSTGNFTCLEVVFTLKRRLVYYVFNTYIPTCMI
VIMSWVSFWIKPEAAPARVTLGVTSLLTLSTQHAKSQSSLPPVSYLKAVD
AFMSVCTVFVFMALMEYCLINIVLSDTPIPKPMAYPPKPVAGDGPKKEGE
GAPPGGSNSTASKQQATMLPLADEKIEKIEKIFDEMTKNRRIVTTTRRVV
RPPLDADGPWIPRQESRIILTPTIAPPPPPPQPAAPEPELPKPKLTPAQE
RLKRAIYIDRSSRVLFPALFASLNGIYWCVFYEYLASFLDH

BO20606.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
ort-PA 485 CG7411-PA 1..485 1..485 2573 100 Plus
HisCl1-PB 422 CG14723-PB 50..348 23..321 1107 65.9 Plus
HisCl1-PA 426 CG14723-PA 50..348 23..321 1107 65.9 Plus
HisCl1-PD 416 CG14723-PD 50..342 23..321 1060 64.2 Plus
GluClalpha-PP 456 CG7535-PP 16..448 10..481 593 31.4 Plus